BLASTX nr result
ID: Atractylodes22_contig00036967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036967 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_683562.1| uncharacterized protein [Arabidopsis thaliana] ... 72 5e-11 ref|XP_002884959.1| hypothetical protein ARALYDRAFT_897553 [Arab... 72 6e-11 ref|XP_002891850.1| hypothetical protein ARALYDRAFT_892575 [Arab... 70 2e-10 ref|XP_003617905.1| hypothetical protein MTR_5g096780 [Medicago ... 67 1e-09 ref|XP_002530619.1| conserved hypothetical protein [Ricinus comm... 65 4e-09 >ref|NP_683562.1| uncharacterized protein [Arabidopsis thaliana] gi|29367152|gb|AAO72719.1| unknown protein [Arabidopsis thaliana] gi|110739300|dbj|BAF01563.1| hypothetical protein [Arabidopsis thaliana] gi|332641806|gb|AEE75327.1| uncharacterized protein [Arabidopsis thaliana] Length = 69 Score = 72.0 bits (175), Expect = 5e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 277 MCCGKICMMCTCLILLVIAIGMLFGFGVFGKAFHKVNNELH 155 MCCG+ICM+CTCL+L+VIAIG LFGFGVF FHK++ +H Sbjct: 1 MCCGRICMLCTCLLLVVIAIGFLFGFGVFKDGFHKIHESIH 41 >ref|XP_002884959.1| hypothetical protein ARALYDRAFT_897553 [Arabidopsis lyrata subsp. lyrata] gi|297330799|gb|EFH61218.1| hypothetical protein ARALYDRAFT_897553 [Arabidopsis lyrata subsp. lyrata] Length = 69 Score = 71.6 bits (174), Expect = 6e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 277 MCCGKICMMCTCLILLVIAIGMLFGFGVFGKAFHKVNNELH 155 MCCG+ICM+CTCL+L+VIAIG LFGFGVF FHK++ +H Sbjct: 1 MCCGRICMLCTCLLLVVIAIGFLFGFGVFRDGFHKIHESVH 41 >ref|XP_002891850.1| hypothetical protein ARALYDRAFT_892575 [Arabidopsis lyrata subsp. lyrata] gi|297337692|gb|EFH68109.1| hypothetical protein ARALYDRAFT_892575 [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 69.7 bits (169), Expect = 2e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -1 Query: 277 MCCGKICMMCTCLILLVIAIGMLFGFGVFGKAFHKVNNELH 155 MCCG+ICM+CTCLIL+VIAIG++FGFGVF F+K++ +H Sbjct: 1 MCCGRICMLCTCLILVVIAIGLVFGFGVFRNGFNKIHETIH 41 >ref|XP_003617905.1| hypothetical protein MTR_5g096780 [Medicago truncatula] gi|355519240|gb|AET00864.1| hypothetical protein MTR_5g096780 [Medicago truncatula] gi|388513919|gb|AFK45021.1| unknown [Medicago truncatula] Length = 65 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -1 Query: 277 MCC-GKICMMCTCLILLVIAIGMLFGFGVFGKAFHKVNNELH 155 MCC GK+CM+C CLIL+VI IGMLFGFGVF FHKV + +H Sbjct: 1 MCCPGKVCMLCVCLILVVITIGMLFGFGVFKNGFHKVKDTVH 42 >ref|XP_002530619.1| conserved hypothetical protein [Ricinus communis] gi|223529829|gb|EEF31762.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/42 (61%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -1 Query: 277 MCCG-KICMMCTCLILLVIAIGMLFGFGVFGKAFHKVNNELH 155 MCCG K+CM+CTC+IL+VIAIG++FGFGV+ FHK+ + +H Sbjct: 1 MCCGGKMCMLCTCVILVVIAIGLIFGFGVYKNGFHKLKDSIH 42