BLASTX nr result
ID: Atractylodes22_contig00036949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036949 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523971.1| Heterochromatin protein, putative [Ricinus c... 69 5e-10 ref|NP_001234750.1| chromo domain protein LHP1 [Solanum lycopers... 67 1e-09 ref|XP_002319745.1| chromodomain protein [Populus trichocarpa] g... 66 3e-09 ref|XP_002273726.1| PREDICTED: chromo domain protein LHP1 [Vitis... 64 1e-08 ref|XP_002325456.1| chromo domain protein [Populus trichocarpa] ... 64 2e-08 >ref|XP_002523971.1| Heterochromatin protein, putative [Ricinus communis] gi|223536698|gb|EEF38339.1| Heterochromatin protein, putative [Ricinus communis] Length = 462 Score = 68.6 bits (166), Expect = 5e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +1 Query: 1 RGWPEATSTWEPVENLMPCSDIVDAFEESMRSGKHRSNRK 120 RGWPEA +TWEP+ENL CSD++DAFEES+RSGK RK Sbjct: 141 RGWPEAANTWEPLENLQSCSDVIDAFEESLRSGKSSRKRK 180 >ref|NP_001234750.1| chromo domain protein LHP1 [Solanum lycopersicum] gi|75306057|sp|Q944N1.2|LHP1_SOLLC RecName: Full=Chromo domain protein LHP1; AltName: Full=Protein LIKE HETEROCHROMATIN PROTEIN 1; AltName: Full=Sl LHP1 gi|66854107|gb|AAL25116.2|AF428244_1 heterochromatin protein 1-like protein [Solanum lycopersicum] Length = 399 Score = 67.4 bits (163), Expect = 1e-09 Identities = 34/83 (40%), Positives = 46/83 (55%) Frame = +1 Query: 1 RGWPEATSTWEPVENLMPCSDIVDAFEESMRSGKHRSNRKCRXXXXXXXXXXXXXXXXXX 180 RGWPE+ +TWEP NL C+DI+DA+EES++SGK R ++ Sbjct: 115 RGWPESANTWEPETNLSSCTDIIDAYEESLKSGKLRRRKR------KFGATQTHPMIKQQ 168 Query: 181 XXXXXPAATDDIPAVKITIVEEP 249 P AT + PAVK+ I+EEP Sbjct: 169 RRFSAPVATYNGPAVKVRIIEEP 191 >ref|XP_002319745.1| chromodomain protein [Populus trichocarpa] gi|222858121|gb|EEE95668.1| chromodomain protein [Populus trichocarpa] Length = 438 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 1 RGWPEATSTWEPVENLMPCSDIVDAFEESMRSGKHRSNRK 120 RGWPE +TWEP+ENL CSD++DAFEES+RSG+ RK Sbjct: 116 RGWPETANTWEPLENLQSCSDVIDAFEESLRSGRSSRKRK 155 >ref|XP_002273726.1| PREDICTED: chromo domain protein LHP1 [Vitis vinifera] gi|296090196|emb|CBI40015.3| unnamed protein product [Vitis vinifera] Length = 424 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = +1 Query: 1 RGWPEATSTWEPVENLMPCSDIVDAFEESMRSGKHRSNRK 120 RGWPE +TWEP+ENL CSD++DAFE+ +RS ++RS+RK Sbjct: 118 RGWPENANTWEPLENLQACSDVIDAFEDRLRSKRNRSSRK 157 >ref|XP_002325456.1| chromo domain protein [Populus trichocarpa] gi|222862331|gb|EEE99837.1| chromo domain protein [Populus trichocarpa] Length = 435 Score = 63.5 bits (153), Expect = 2e-08 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +1 Query: 1 RGWPEATSTWEPVENLMPCSDIVDAFEESMRSGKHRSNRK 120 RGWPE +TWEP+ENL C+D++DAFEES++SGK RK Sbjct: 116 RGWPETANTWEPLENLQSCADVIDAFEESLQSGKSFRKRK 155