BLASTX nr result
ID: Atractylodes22_contig00036840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036840 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319808.1| predicted protein [Populus trichocarpa] gi|2... 54 2e-11 gb|AAF82236.1|AC069143_12 Contains similarity to a transposable ... 41 4e-08 ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerizat... 41 4e-08 gb|EAY96851.1| hypothetical protein OsI_18772 [Oryza sativa Indi... 45 6e-08 ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago trunc... 40 2e-07 >ref|XP_002319808.1| predicted protein [Populus trichocarpa] gi|222858184|gb|EEE95731.1| predicted protein [Populus trichocarpa] Length = 788 Score = 54.3 bits (129), Expect(2) = 2e-11 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 6/68 (8%) Frame = +2 Query: 62 MDKYITKRKRVVDPENKNAEG------SKQSHIHINLNELLADHGLRIKILDYNANIRDE 223 +DKY KRK + D E+ A SK+SHI IN + LLAD GLR I +Y+ N RD Sbjct: 3 LDKYF-KRKSLEDEESIKASSHVTQSSSKKSHIEINPDTLLADPGLRRPIYEYHINDRDA 61 Query: 224 VRRSYLLK 247 +RR+YL K Sbjct: 62 IRRAYLQK 69 Score = 39.3 bits (90), Expect(2) = 2e-11 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = +3 Query: 246 KGPCQPRNHEFPYTAFGSKS--RRFNHAWF 329 KGPCQP + +FP FG+ S RRFN AWF Sbjct: 69 KGPCQPSHCDFPQKQFGNISTLRRFNPAWF 98 >gb|AAF82236.1|AC069143_12 Contains similarity to a transposable element Tip100 protein for transposase from Ipomoea purpurea gb|4063769 and is a member of the transmembrane 4 family PF|00335 [Arabidopsis thaliana] Length = 811 Score = 41.2 bits (95), Expect(2) = 4e-08 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +3 Query: 246 KGPCQPRNHEFPYTAFGSKSRRFNHAWF 329 +GPCQPR H+F A G RRFN WF Sbjct: 90 RGPCQPRGHKFKQIAIGKVLRRFNPKWF 117 Score = 40.8 bits (94), Expect(2) = 4e-08 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = +2 Query: 146 INLNELLADHGLRIKILDYNANIRDEVRRSYLLK 247 INLNEL +D R IL Y+ N RDEVRR YL++ Sbjct: 57 INLNELPSDPAKRKSILSYHPNQRDEVRREYLIR 90 >ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] gi|332191703|gb|AEE29824.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] Length = 769 Score = 41.2 bits (95), Expect(2) = 4e-08 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +3 Query: 246 KGPCQPRNHEFPYTAFGSKSRRFNHAWF 329 +GPCQPR H+F A G RRFN WF Sbjct: 48 RGPCQPRGHKFKQIAIGKVLRRFNPKWF 75 Score = 40.8 bits (94), Expect(2) = 4e-08 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = +2 Query: 146 INLNELLADHGLRIKILDYNANIRDEVRRSYLLK 247 INLNEL +D R IL Y+ N RDEVRR YL++ Sbjct: 15 INLNELPSDPAKRKSILSYHPNQRDEVRREYLIR 48 >gb|EAY96851.1| hypothetical protein OsI_18772 [Oryza sativa Indica Group] Length = 758 Score = 44.7 bits (104), Expect(2) = 6e-08 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Frame = +2 Query: 92 VVDPENKNAEGSKQSHIHI--NLNELLADHGLRIKILDYNANIRDEVRRSYLL 244 V + EN AE +K+ + I NL++++AD GLR I +Y+ IRD+VR YLL Sbjct: 18 VAEDENPKAEVAKKPRVGIVLNLDDVVADPGLRRPIEEYDVGIRDQVRTKYLL 70 Score = 37.0 bits (84), Expect(2) = 6e-08 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +3 Query: 249 GPCQPRNHEFPYTAFGSKSRRFNHAWF 329 GPCQP H+FP G SR F AWF Sbjct: 72 GPCQPAGHKFPRKQQGDGSRSFIEAWF 98 >ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355516931|gb|AES98554.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 892 Score = 40.0 bits (92), Expect(2) = 2e-07 Identities = 22/63 (34%), Positives = 37/63 (58%) Frame = +2 Query: 59 VMDKYITKRKRVVDPENKNAEGSKQSHIHINLNELLADHGLRIKILDYNANIRDEVRRSY 238 +M+ ++ KR R + + +GS H+ NL EL +D G R K+ Y+ N ++ +RR+Y Sbjct: 113 IMENFL-KRSR-----SSHEQGSSSQHVSCNLEELPSDPGKRPKMSTYHPNDQEIIRRAY 166 Query: 239 LLK 247 L K Sbjct: 167 LQK 169 Score = 40.0 bits (92), Expect(2) = 2e-07 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +3 Query: 246 KGPCQPRNHEFPYTAFGSKSRRFNHAWF 329 KGPCQP H FP G+ RRF +WF Sbjct: 169 KGPCQPNQHNFPQRKIGNSMRRFCPSWF 196