BLASTX nr result
ID: Atractylodes22_contig00036793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036793 (1085 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA10128.1| beta-galactosidase [Cicer arietinum] 58 5e-06 ref|XP_002305449.1| predicted protein [Populus trichocarpa] gi|2... 57 8e-06 >emb|CAA10128.1| beta-galactosidase [Cicer arietinum] Length = 745 Score = 57.8 bits (138), Expect = 5e-06 Identities = 33/65 (50%), Positives = 40/65 (61%) Frame = +3 Query: 15 WEGIKLLTKIGSVSVF*YAYVCSVSSFDEFSCSHYNFEGRYDLVKFIKLVQETGLYVHRR 194 WE + K+G + V +V E S S+YNFEGRYDLV+FIK VQ+ GLYVH R Sbjct: 59 WEDLIQKAKVGGLDVIDTYVFWNVH---EPSPSNYNFEGRYDLVRFIKTVQKVGLYVHLR 115 Query: 195 ICPSV 209 I P V Sbjct: 116 IGPYV 120 >ref|XP_002305449.1| predicted protein [Populus trichocarpa] gi|222848413|gb|EEE85960.1| predicted protein [Populus trichocarpa] Length = 731 Score = 57.0 bits (136), Expect = 8e-06 Identities = 33/65 (50%), Positives = 40/65 (61%) Frame = +3 Query: 15 WEGIKLLTKIGSVSVF*YAYVCSVSSFDEFSCSHYNFEGRYDLVKFIKLVQETGLYVHRR 194 WEG+ K G + V YV + E S +YNF+GRYDLV+FIKLV E GLYVH R Sbjct: 59 WEGLIQKAKDGGLDVI-DTYV--FWNLHEPSPGNYNFDGRYDLVRFIKLVHEAGLYVHLR 115 Query: 195 ICPSV 209 I P + Sbjct: 116 IGPYI 120