BLASTX nr result
ID: Atractylodes22_contig00036725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036725 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK28489.1| unknown [Arabidopsis thaliana] 39 1e-06 ref|NP_178997.2| uncharacterized protein [Arabidopsis thaliana] ... 39 1e-06 >gb|ABK28489.1| unknown [Arabidopsis thaliana] Length = 344 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 2 ENPRFHYLILRQRFQIGHSLFLCIFDAIASHDNHVALR 115 E P F + R+RF++ SLFL I+DAI HDN+ R Sbjct: 84 EKPVFPETMFRRRFRMSRSLFLRIYDAIKRHDNYFVQR 121 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +3 Query: 117 GVHRLGSSGLQKVTFVFRTLACCVLTYSTD*YIKI 221 GV +LG SGLQK+T FR LA V STD YIKI Sbjct: 124 GVGKLGLSGLQKMTAAFRMLAYGVPADSTDEYIKI 158 >ref|NP_178997.2| uncharacterized protein [Arabidopsis thaliana] gi|91806160|gb|ABE65808.1| hypothetical protein At2g13770 [Arabidopsis thaliana] gi|330251164|gb|AEC06258.1| uncharacterized protein [Arabidopsis thaliana] Length = 343 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 2 ENPRFHYLILRQRFQIGHSLFLCIFDAIASHDNHVALR 115 E P F + R+RF++ SLFL I+DAI HDN+ R Sbjct: 84 EKPVFPETMFRRRFRMSRSLFLRIYDAIKRHDNYFVQR 121 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +3 Query: 117 GVHRLGSSGLQKVTFVFRTLACCVLTYSTD*YIKI 221 GV +LG SGLQK+T FR LA V STD YIKI Sbjct: 124 GVGKLGLSGLQKMTAAFRMLAYGVPADSTDEYIKI 158