BLASTX nr result
ID: Atractylodes22_contig00036637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036637 (501 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527493.1| conserved hypothetical protein [Ricinus comm... 55 4e-06 >ref|XP_002527493.1| conserved hypothetical protein [Ricinus communis] gi|223533133|gb|EEF34891.1| conserved hypothetical protein [Ricinus communis] Length = 357 Score = 55.5 bits (132), Expect = 4e-06 Identities = 32/72 (44%), Positives = 40/72 (55%), Gaps = 10/72 (13%) Frame = +1 Query: 1 EPCIRLARPRITKT---------APIFNGTLPGTYRQRPRIST-ASLLDFSVALECDPHK 150 EPC+ LA R + AP N LPG Y QRP S AS+LDF A++ +P Sbjct: 279 EPCMGLASSRCGRDHLRKDSDQFAPGSNEILPGRYMQRPTESVYASMLDFHAAMQVNPQI 338 Query: 151 FGGDWSTQLEKL 186 GGDW+T LEK+ Sbjct: 339 LGGDWATSLEKI 350