BLASTX nr result
ID: Atractylodes22_contig00036442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036442 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148866.1| PREDICTED: probable LRR receptor-like serine... 62 6e-08 ref|XP_002306108.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002509489.1| lrr receptor protein kinase, putative [Ricin... 61 1e-07 ref|XP_003527625.1| PREDICTED: probable LRR receptor-like serine... 59 3e-07 emb|CBI32593.3| unnamed protein product [Vitis vinifera] 59 4e-07 >ref|XP_004148866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Cucumis sativus] gi|449507355|ref|XP_004163008.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Cucumis sativus] Length = 896 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 LDDKYEVRLGSLSEACTQEDDSHSNRITRLLRLPQ 105 LDDK+EVRLGSLSE C Q+ DSH NRI+RLLRLPQ Sbjct: 653 LDDKFEVRLGSLSEVCAQDGDSHQNRISRLLRLPQ 687 >ref|XP_002306108.1| predicted protein [Populus trichocarpa] gi|222849072|gb|EEE86619.1| predicted protein [Populus trichocarpa] Length = 697 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 1 LDDKYEVRLGSLSEACTQEDDSHSNRITRLLRLPQ 105 LDDK+EVRLGSLSE CTQE D+H +RI+RLLRLPQ Sbjct: 663 LDDKFEVRLGSLSEVCTQEGDTHQSRISRLLRLPQ 697 >ref|XP_002509489.1| lrr receptor protein kinase, putative [Ricinus communis] gi|223549388|gb|EEF50876.1| lrr receptor protein kinase, putative [Ricinus communis] Length = 901 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 LDDKYEVRLGSLSEACTQEDDSHSNRITRLLRLPQ 105 LDDK+EVRLGSLSE C QE D+H +RITRLLRLPQ Sbjct: 657 LDDKFEVRLGSLSEVCPQEGDAHQSRITRLLRLPQ 691 >ref|XP_003527625.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Glycine max] Length = 898 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 1 LDDKYEVRLGSLSEACTQEDDSHSNRITRLLRLPQ 105 LDDKYEVRLGSLSE+C QE D H ++ITR LRLPQ Sbjct: 651 LDDKYEVRLGSLSESCAQEGDIHQSKITRFLRLPQ 685 >emb|CBI32593.3| unnamed protein product [Vitis vinifera] Length = 712 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 1 LDDKYEVRLGSLSEACTQEDDSHSNRITRLLRLPQ 105 LDDK+EVRLGSLSE C+QE D+H N ITR LRLPQ Sbjct: 465 LDDKFEVRLGSLSEVCSQEGDTHQNVITRFLRLPQ 499