BLASTX nr result
ID: Atractylodes22_contig00036277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036277 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_002514322.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|222873229|gb|EEF10360.1| predicted protein [Populus trichocarpa] Length = 88 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +1 Query: 118 RLAAHVGGGEEVGRVIKKQCLCSPTLHPGSFRCKHHHSDYVWVGRL 255 R GGG + R I K CLCSPT HPGSFRC+HH SDYVW GR+ Sbjct: 34 RTEVAAGGGSAISRSINK-CLCSPTRHPGSFRCRHHRSDYVWSGRI 78 >ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|222865848|gb|EEF02979.1| predicted protein [Populus trichocarpa] Length = 85 Score = 62.4 bits (150), Expect = 4e-08 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 11/81 (13%) Frame = +1 Query: 46 MCYPYPPAVPCITTGY--YDLEMRIRRLAAHVG---------GGEEVGRVIKKQCLCSPT 192 MC+P P VP ++ Y + ++ + G G V IKK CLCSPT Sbjct: 1 MCHP--PGVPWVSRNLVVYRRWLVLQAVETETGHAPTEVAATGSSAVAGSIKK-CLCSPT 57 Query: 193 LHPGSFRCKHHHSDYVWVGRL 255 HPGSFRC+HH SDYVW GR+ Sbjct: 58 RHPGSFRCRHHRSDYVWGGRI 78 >ref|XP_002514322.1| conserved hypothetical protein [Ricinus communis] gi|223546778|gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = +1 Query: 136 GGGEEVGRVIKKQCLCSPTLHPGSFRCKHHHSDYVWVGRL 255 GGG + K C+CSPT HPGSFRC+HHH DY W R+ Sbjct: 53 GGGGSI-----KMCVCSPTRHPGSFRCRHHHVDYAWGRRI 87