BLASTX nr result
ID: Atractylodes22_contig00036099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036099 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEV42261.1| hypothetical protein [Beta vulgaris] 57 1e-06 gb|ACY01928.1| hypothetical protein [Beta vulgaris] 57 1e-06 >gb|AEV42261.1| hypothetical protein [Beta vulgaris] Length = 1396 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 168 PKGPTPVKS-FTQFNSSNPPNLRTTMPSNPIPGEVRRLTDKELQSKREEGLCFRCDD 1 PK P P +S F+ + +P +T +P GE+RRL++KELQ KRE GLCFRCDD Sbjct: 257 PKHPAPPQSVFSSPSIVSPAKTKTHIPIARPYGEIRRLSEKELQHKRERGLCFRCDD 313 >gb|ACY01928.1| hypothetical protein [Beta vulgaris] Length = 1583 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/60 (50%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -1 Query: 177 NNGPKGPTPVKSFTQFNSSNPPNL-RTTMPSNPIPGEVRRLTDKELQSKREEGLCFRCDD 1 +N P P S S N PN +TT+P GE+RRL++KELQ KRE GLCFRCD+ Sbjct: 297 HNTPYNQFPAPSHHSSTSINSPNKPKTTLPIAKPFGEIRRLSEKELQYKREHGLCFRCDE 356