BLASTX nr result
ID: Atractylodes22_contig00036068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036068 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283101.1| PREDICTED: origin recognition complex subuni... 101 5e-20 emb|CBI15609.3| unnamed protein product [Vitis vinifera] 101 5e-20 ref|XP_004159766.1| PREDICTED: origin recognition complex subuni... 100 2e-19 ref|XP_004138588.1| PREDICTED: origin recognition complex subuni... 100 2e-19 ref|XP_002320803.1| predicted protein [Populus trichocarpa] gi|2... 99 4e-19 >ref|XP_002283101.1| PREDICTED: origin recognition complex subunit 5-like [Vitis vinifera] Length = 541 Score = 101 bits (252), Expect = 5e-20 Identities = 48/52 (92%), Positives = 52/52 (100%) Frame = +1 Query: 1 LQVSSLCNANYISKGGSCPLEGSTRYRSTVSEDLALKVARSLKFPLSKYLYR 156 LQ+SSLCNAN+ISKGGSCPLEGSTRYR+T+SEDLALKVARSLKFPLSKYLYR Sbjct: 489 LQLSSLCNANFISKGGSCPLEGSTRYRATISEDLALKVARSLKFPLSKYLYR 540 >emb|CBI15609.3| unnamed protein product [Vitis vinifera] Length = 524 Score = 101 bits (252), Expect = 5e-20 Identities = 48/52 (92%), Positives = 52/52 (100%) Frame = +1 Query: 1 LQVSSLCNANYISKGGSCPLEGSTRYRSTVSEDLALKVARSLKFPLSKYLYR 156 LQ+SSLCNAN+ISKGGSCPLEGSTRYR+T+SEDLALKVARSLKFPLSKYLYR Sbjct: 472 LQLSSLCNANFISKGGSCPLEGSTRYRATISEDLALKVARSLKFPLSKYLYR 523 >ref|XP_004159766.1| PREDICTED: origin recognition complex subunit 5-like [Cucumis sativus] Length = 536 Score = 100 bits (248), Expect = 2e-19 Identities = 46/53 (86%), Positives = 52/53 (98%) Frame = +1 Query: 1 LQVSSLCNANYISKGGSCPLEGSTRYRSTVSEDLALKVARSLKFPLSKYLYRR 159 LQ+SSLCNAN++ KGGSCPLEGSTRYRSTVSED+ALKVARS+KFPLSKY+YRR Sbjct: 484 LQLSSLCNANFVVKGGSCPLEGSTRYRSTVSEDMALKVARSIKFPLSKYMYRR 536 >ref|XP_004138588.1| PREDICTED: origin recognition complex subunit 5-like [Cucumis sativus] Length = 536 Score = 100 bits (248), Expect = 2e-19 Identities = 46/53 (86%), Positives = 52/53 (98%) Frame = +1 Query: 1 LQVSSLCNANYISKGGSCPLEGSTRYRSTVSEDLALKVARSLKFPLSKYLYRR 159 LQ+SSLCNAN++ KGGSCPLEGSTRYRSTVSED+ALKVARS+KFPLSKY+YRR Sbjct: 484 LQLSSLCNANFVVKGGSCPLEGSTRYRSTVSEDMALKVARSIKFPLSKYMYRR 536 >ref|XP_002320803.1| predicted protein [Populus trichocarpa] gi|222861576|gb|EEE99118.1| predicted protein [Populus trichocarpa] Length = 536 Score = 99.0 bits (245), Expect = 4e-19 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = +1 Query: 1 LQVSSLCNANYISKGGSCPLEGSTRYRSTVSEDLALKVARSLKFPLSKYLYRR 159 LQ+SSLCNAN+I KGGSCPLEGSTRYRSTVSEDLALKVARSLKFPL YLYRR Sbjct: 484 LQLSSLCNANFIIKGGSCPLEGSTRYRSTVSEDLALKVARSLKFPLPNYLYRR 536