BLASTX nr result
ID: Atractylodes22_contig00036026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036026 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08404.1| Retrotransposon gag protein [Medicago truncatula]... 56 3e-06 ref|XP_003636545.1| Pentatricopeptide repeat-containing protein ... 55 5e-06 >gb|ABN08404.1| Retrotransposon gag protein [Medicago truncatula] gi|124360393|gb|ABN08406.1| Retrotransposon gag protein [Medicago truncatula] Length = 224 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/80 (36%), Positives = 42/80 (52%) Frame = -1 Query: 241 SKEPPSSGVFDYNGSPLRPNLDQFVRNDHFETSLFSLPKVKLPLFEGVDPRGWITKAELY 62 SKE YN S + + ++ + S+ KV+L +F G DP GWI +AE+Y Sbjct: 45 SKEKNVGESSHYNESVGNKKKNSELHDEALDEFRLSVKKVELLMFNGDDPAGWIARAEVY 104 Query: 61 FQVHQSPPSQKMRLTQMCMD 2 F V + P K+ L Q+CMD Sbjct: 105 FNVQNTTPEIKVNLAQLCMD 124 >ref|XP_003636545.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502480|gb|AES83683.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1280 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/59 (42%), Positives = 40/59 (67%) Frame = -1 Query: 178 DQFVRNDHFETSLFSLPKVKLPLFEGVDPRGWITKAELYFQVHQSPPSQKMRLTQMCMD 2 +++V + E+ L KVKLPLFEG DP WIT+AE+YF V +P +++L+++ M+ Sbjct: 730 EEYVESSQNESRLAG-KKVKLPLFEGDDPVAWITRAEIYFDVQNTPDDMRVKLSRLSME 787