BLASTX nr result
ID: Atractylodes22_contig00035889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00035889 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553382.1| PREDICTED: protein arv1 homolog [Glycine max] 75 6e-12 ref|XP_003521125.1| PREDICTED: protein arv1 homolog [Glycine max] 75 7e-12 ref|XP_003624961.1| ARV1 [Medicago truncatula] gi|355499976|gb|A... 74 2e-11 ref|XP_002515102.1| arv1, putative [Ricinus communis] gi|2235455... 72 5e-11 ref|XP_002268438.1| PREDICTED: protein arv1 homolog [Vitis vinif... 72 6e-11 >ref|XP_003553382.1| PREDICTED: protein arv1 homolog [Glycine max] Length = 247 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 168 MNFRCFQCRYHIKTLYVQYSPGNIRLMKCQNCRAVADEYIE 290 M +RC QC +KTLYVQYSPGNIRLMKC+NC+AVADEYIE Sbjct: 1 MGYRCIQCGCPVKTLYVQYSPGNIRLMKCENCKAVADEYIE 41 >ref|XP_003521125.1| PREDICTED: protein arv1 homolog [Glycine max] Length = 250 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 168 MNFRCFQCRYHIKTLYVQYSPGNIRLMKCQNCRAVADEYIE 290 M +RC QC +KTLYVQYSPGNIRLMKC+NC+AVADEYIE Sbjct: 1 MGYRCIQCWCPVKTLYVQYSPGNIRLMKCENCKAVADEYIE 41 >ref|XP_003624961.1| ARV1 [Medicago truncatula] gi|355499976|gb|AES81179.1| ARV1 [Medicago truncatula] Length = 293 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 168 MNFRCFQCRYHIKTLYVQYSPGNIRLMKCQNCRAVADEYIE 290 M +RC QC + I TLY QYSPGNIRLMKC+NC+AVADEYIE Sbjct: 1 MGYRCIQCGFTINTLYFQYSPGNIRLMKCENCKAVADEYIE 41 >ref|XP_002515102.1| arv1, putative [Ricinus communis] gi|223545582|gb|EEF47086.1| arv1, putative [Ricinus communis] Length = 187 Score = 72.0 bits (175), Expect = 5e-11 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +3 Query: 174 FRCFQCRYHIKTLYVQYSPGNIRLMKCQNCRAVADEYIE 290 +RC +C + +K+LYVQYSPGNIRLMKC+NC+AVADEYIE Sbjct: 2 YRCVECGFGVKSLYVQYSPGNIRLMKCENCKAVADEYIE 40 >ref|XP_002268438.1| PREDICTED: protein arv1 homolog [Vitis vinifera] gi|296089029|emb|CBI38732.3| unnamed protein product [Vitis vinifera] Length = 248 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +3 Query: 168 MNFRCFQCRYHIKTLYVQYSPGNIRLMKCQNCRAVADEYIE 290 M RC C + IKTL++QYSPGNIRLMKC+NC+AVADEYIE Sbjct: 1 MELRCIHCGFPIKTLFLQYSPGNIRLMKCENCKAVADEYIE 41