BLASTX nr result
ID: Atractylodes22_contig00035571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00035571 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268034.2| PREDICTED: uncharacterized protein LOC100244... 60 1e-07 emb|CAN66248.1| hypothetical protein VITISV_033018 [Vitis vinifera] 56 3e-06 ref|NP_180394.1| cysteine/histidine-rich C1 domain-containing pr... 55 6e-06 ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing pr... 55 8e-06 >ref|XP_002268034.2| PREDICTED: uncharacterized protein LOC100244183 [Vitis vinifera] Length = 309 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/88 (35%), Positives = 49/88 (55%), Gaps = 3/88 (3%) Frame = -1 Query: 410 ERVQREDHEHALSLLHVNPFE---TFECDVCRGAIAQNHCMYYCTSGCDYGMHVNCVNAK 240 E V R DH+H L+L + E TF CDVC G + +YYC S CDYG H+ C A+ Sbjct: 200 ETVIRGDHQHPLTLFYCGYKEEGNTFICDVCHGNVPDGCWIYYCKS-CDYGTHLGCATAE 258 Query: 239 VSEKAPMDAMTFQLEMFKLQNKMRVHEM 156 S A + T + M + ++++++ ++ Sbjct: 259 ASPVAEEEEGTEEYSMAEAESRLKLLQL 286 >emb|CAN66248.1| hypothetical protein VITISV_033018 [Vitis vinifera] Length = 190 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/65 (44%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Frame = -1 Query: 410 ERVQREDHEHALSLLHVNPFE---TFECDVCRGAIAQNHCMYYCTSGCDYGMHVNCVNAK 240 E V R DH+H L+L + E TF CDVC G + +YYC S CDYG H+ C A+ Sbjct: 72 ETVIRGDHQHPLTLFYCGYKEEGNTFICDVCHGNVPDGCWIYYCKS-CDYGTHLGCATAE 130 Query: 239 VSEKA 225 S A Sbjct: 131 ASPVA 135 >ref|NP_180394.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|4803954|gb|AAD29826.1| unknown protein [Arabidopsis thaliana] gi|330253004|gb|AEC08098.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 248 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 6/58 (10%) Frame = -1 Query: 410 ERVQREDHEHALSLLHVNPFE------TFECDVCRGAIAQNHCMYYCTSGCDYGMHVN 255 E V+REDHEH L+LL+ P + F CDVC +++N +YYC CDYG HV+ Sbjct: 122 ENVKREDHEHPLTLLYNTPCKGRKDGVVFICDVCEVDVSENLWVYYCKE-CDYGTHVH 178 >ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3128201|gb|AAC16105.1| unknown protein [Arabidopsis thaliana] gi|37202108|gb|AAQ89669.1| At2g44380 [Arabidopsis thaliana] gi|51971661|dbj|BAD44495.1| unknown protein [Arabidopsis thaliana] gi|330255320|gb|AEC10414.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 247 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 6/58 (10%) Frame = -1 Query: 410 ERVQREDHEHALSLLHVNPFE------TFECDVCRGAIAQNHCMYYCTSGCDYGMHVN 255 E V+REDHEH L+LL+ P + F CDVC +++N +YYC CDYG HV+ Sbjct: 122 ETVEREDHEHPLTLLYNTPCKGREDGAKFICDVCEEKMSENLWVYYCKE-CDYGTHVH 178