BLASTX nr result
ID: Atractylodes22_contig00035371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00035371 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus ... 73 2e-11 ref|XP_002306421.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-10 ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR28... 66 3e-09 ref|NP_201399.1| auxin efflux carrier family protein [Arabidopsi... 65 7e-09 ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp.... 65 7e-09 >ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223539130|gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 406 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = +2 Query: 128 MGFWSLFVVASMPIVEVLLVIAIGAIMATDYLNLLSSDTRTSLNKIVF 271 MGFW+LF VASMPI++VLL+ +GA MAT+Y NLL+SD R SLNKIVF Sbjct: 1 MGFWTLFEVASMPIIQVLLISGLGAFMATNYCNLLTSDARKSLNKIVF 48 >ref|XP_002306421.1| predicted protein [Populus trichocarpa] gi|222855870|gb|EEE93417.1| predicted protein [Populus trichocarpa] Length = 397 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = +2 Query: 128 MGFWSLFVVASMPIVEVLLVIAIGAIMATDYLNLLSSDTRTSLNKIVF 271 MGFW+LF VAS+PI++VLL+ GA+MAT+YLNLL D R SLNK+VF Sbjct: 1 MGFWTLFEVASLPIIQVLLISFFGALMATEYLNLLPKDARKSLNKLVF 48 >ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR287W-like [Vitis vinifera] gi|296082565|emb|CBI21570.3| unnamed protein product [Vitis vinifera] Length = 421 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/48 (60%), Positives = 40/48 (83%) Frame = +2 Query: 128 MGFWSLFVVASMPIVEVLLVIAIGAIMATDYLNLLSSDTRTSLNKIVF 271 MGFW+LF VASMPI++VL++ ++GA +AT Y N+L +D R S+NKIVF Sbjct: 1 MGFWTLFEVASMPILQVLIIGSVGAFLATGYCNILPADARKSVNKIVF 48 >ref|NP_201399.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|10177113|dbj|BAB10403.1| unnamed protein product [Arabidopsis thaliana] gi|332010751|gb|AED98134.1| auxin efflux carrier family protein [Arabidopsis thaliana] Length = 395 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 128 MGFWSLFVVASMPIVEVLLVIAIGAIMATDYLNLLSSDTRTSLNKIVF 271 MGF L VASMPIV+VLL+ +GA +ATDY +LLS+DTR S+NK+VF Sbjct: 1 MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVF 48 >ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297312615|gb|EFH43039.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 395 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 128 MGFWSLFVVASMPIVEVLLVIAIGAIMATDYLNLLSSDTRTSLNKIVF 271 MGF L VASMPIV+VLL+ +GA +ATDY +LLS+DTR S+NK+VF Sbjct: 1 MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVF 48