BLASTX nr result
ID: Atractylodes22_contig00035238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00035238 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513095.1| Disease resistance protein RPM1, putative [R... 65 8e-09 ref|XP_002510231.1| Disease resistance protein RPP13, putative [... 63 2e-08 >ref|XP_002513095.1| Disease resistance protein RPM1, putative [Ricinus communis] gi|223548106|gb|EEF49598.1| Disease resistance protein RPM1, putative [Ricinus communis] Length = 936 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/74 (40%), Positives = 50/74 (67%) Frame = +2 Query: 2 LVQKCFEDLVDRSMIQITKLRSDNSPRQCRLVSVLHDYLLPKAQDISLFYIHRSLEYFED 181 LV+ FE+LV R+MI + K R D SP+ C++ + L+D +LP A D+ F++HR+ +Y + Sbjct: 456 LVETHFEELVIRNMIVVEKWRLDGSPKTCKVQAALYDTILPTATDMGFFHVHRNYDYKDK 515 Query: 182 AGGPFGVRRMIQHM 223 PF VRR+ +++ Sbjct: 516 P--PFNVRRIAEYL 527 >ref|XP_002510231.1| Disease resistance protein RPP13, putative [Ricinus communis] gi|223550932|gb|EEF52418.1| Disease resistance protein RPP13, putative [Ricinus communis] Length = 974 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/80 (35%), Positives = 50/80 (62%) Frame = +2 Query: 2 LVQKCFEDLVDRSMIQITKLRSDNSPRQCRLVSVLHDYLLPKAQDISLFYIHRSLEYFED 181 LV+K +DL+ R+MI ++K RSD SP++CR+ +L+D + P A +I F++ RSL Y + Sbjct: 605 LVEKYLQDLIQRNMIDVSKWRSDESPKRCRVPGILYDNVFPSAAEIGFFHVLRSLNYDQQ 664 Query: 182 AGGPFGVRRMIQHMSTTGAI 241 +RR+ ++ + + Sbjct: 665 C----NIRRVAAYLDISNPV 680