BLASTX nr result
ID: Atractylodes22_contig00035204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00035204 (574 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283796.1| PREDICTED: pentatricopeptide repeat-containi... 72 5e-11 emb|CBI22243.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_003618525.1| hypothetical protein MTR_6g012640 [Medicago ... 69 4e-10 ref|XP_002324070.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 ref|XP_004170804.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 >ref|XP_002283796.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Vitis vinifera] Length = 550 Score = 72.4 bits (176), Expect = 5e-11 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = -2 Query: 573 ASQGEWDGAERLRKVMDDKGVRKEAASSLVDADEESLMCFLFDSKPQTTAGK 418 AS+GEWDG E++RK+MDD GVRKEA SL++ D ++LM FLFDSKP+ + K Sbjct: 491 ASRGEWDGVEKVRKLMDDSGVRKEAGCSLIEGDNKALMHFLFDSKPKLNSRK 542 >emb|CBI22243.3| unnamed protein product [Vitis vinifera] Length = 526 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -2 Query: 573 ASQGEWDGAERLRKVMDDKGVRKEAASSLVDADEESLMCFLFDSKP 436 AS+GEWDG E++RK+MDD GVRKEA SL++ D ++LM FLFDSKP Sbjct: 456 ASRGEWDGVEKVRKLMDDSGVRKEAGCSLIEGDNKALMHFLFDSKP 501 >ref|XP_003618525.1| hypothetical protein MTR_6g012640 [Medicago truncatula] gi|355493540|gb|AES74743.1| hypothetical protein MTR_6g012640 [Medicago truncatula] Length = 77 Score = 69.3 bits (168), Expect = 4e-10 Identities = 32/57 (56%), Positives = 45/57 (78%) Frame = -3 Query: 350 KKMMMNEKMKALMIGVVGAGITLSAYSQTYMTPTQCIGTGLVVLIIGLFVGEGLLPL 180 +K M++ KAL+IG++GA TL AYSQT+++P+Q I GL+VL+ GL VGEGL+PL Sbjct: 17 EKKKMSQNTKALLIGLIGAAFTLFAYSQTFISPSQSITIGLLVLMFGLLVGEGLIPL 73 >ref|XP_002324070.1| predicted protein [Populus trichocarpa] gi|222867072|gb|EEF04203.1| predicted protein [Populus trichocarpa] Length = 546 Score = 69.3 bits (168), Expect = 4e-10 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = -2 Query: 573 ASQGEWDGAERLRKVMDDKGVRKEAASSLVDADEESLMCFLFDSKPQ 433 AS GEWDGAE +RK+MDD GVRKEA SL++AD+ ++M FLFD KP+ Sbjct: 492 ASAGEWDGAEEVRKLMDDGGVRKEAGRSLIEADDRAVMQFLFDPKPK 538 >ref|XP_004170804.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like, partial [Cucumis sativus] Length = 315 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = -2 Query: 573 ASQGEWDGAERLRKVMDDKGVRKEAASSLVDADEESLMCFLFDSKPQTTAG 421 ASQGEWDG +++RK+MDD GV+K+ SL+D+D LM FLFDSKP G Sbjct: 264 ASQGEWDGVQKVRKLMDDGGVKKKVGHSLIDSDNSFLMHFLFDSKPNFVEG 314