BLASTX nr result
ID: Atractylodes22_contig00035159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00035159 (437 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522461.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 emb|CBI31940.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_002272133.1| PREDICTED: uncharacterized protein LOC100262... 59 4e-07 ref|XP_004135169.1| PREDICTED: uncharacterized protein LOC101217... 58 9e-07 >ref|XP_002522461.1| conserved hypothetical protein [Ricinus communis] gi|223538346|gb|EEF39953.1| conserved hypothetical protein [Ricinus communis] Length = 151 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = -1 Query: 437 KLQPTPHQQARSRRSAYAPADEGEVDDGSPNLSASDDQGSELDLTNDNKSHFEDENH 267 KLQPTP+ Q RSRRSAYAPAD+ + D GS N ++S+++ S D DNKS ED+++ Sbjct: 94 KLQPTPNNQMRSRRSAYAPADDYDGDGGS-NRTSSEEENSAPDAEGDNKSAPEDQSY 149 >emb|CBI31940.3| unnamed protein product [Vitis vinifera] Length = 273 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -1 Query: 437 KLQPTPHQQARSRRSAYAPADEGEVDDGSPNLSASDDQGSELDLTNDN 294 KLQPTPHQQ RSRRSAYAP D+GE D G+ N + +DQ L+ +N+N Sbjct: 216 KLQPTPHQQVRSRRSAYAPPDDGE-DAGNDNDPSCEDQSCALEGSNEN 262 >ref|XP_002272133.1| PREDICTED: uncharacterized protein LOC100262011 isoform 1 [Vitis vinifera] gi|359473296|ref|XP_003631285.1| PREDICTED: uncharacterized protein LOC100262011 isoform 2 [Vitis vinifera] Length = 158 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -1 Query: 437 KLQPTPHQQARSRRSAYAPADEGEVDDGSPNLSASDDQGSELDLTNDN 294 KLQPTPHQQ RSRRSAYAP D+GE D G+ N + +DQ L+ +N+N Sbjct: 101 KLQPTPHQQVRSRRSAYAPPDDGE-DAGNDNDPSCEDQSCALEGSNEN 147 >ref|XP_004135169.1| PREDICTED: uncharacterized protein LOC101217483 [Cucumis sativus] gi|449478384|ref|XP_004155303.1| PREDICTED: uncharacterized protein LOC101227722 [Cucumis sativus] Length = 159 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -1 Query: 437 KLQPTPHQQARSRRSAYAPADEGEVDDGSPNLSASDDQGSELDLTNDNKS 288 KLQPTPHQQ RSRRSAYAPAD+ E DG+ + +A D Q + ND+ S Sbjct: 103 KLQPTPHQQVRSRRSAYAPADDSEGTDGNIDPAAEDQQSTLESGCNDHVS 152