BLASTX nr result
ID: Atractylodes22_contig00035056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00035056 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK47591.1| unknown [Medicago truncatula] 73 3e-12 ref|XP_003593984.1| RING finger and CHY zinc finger domain-conta... 73 3e-12 gb|AEX97080.1| zinc-finger protein [Malus x domestica] 66 3e-10 gb|AFK36462.1| unknown [Lotus japonicus] 65 5e-10 ref|XP_002516875.1| zinc finger protein, putative [Ricinus commu... 64 9e-10 >gb|AFK47591.1| unknown [Medicago truncatula] Length = 267 Score = 72.8 bits (177), Expect(2) = 3e-12 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 179 QYLFDSLKDTTIMKCGHTMHCECFHEMIKRDK 84 +YLFDSLKDTT+MKCGHTMHCEC+HEMIKRDK Sbjct: 158 EYLFDSLKDTTVMKCGHTMHCECYHEMIKRDK 189 Score = 23.5 bits (49), Expect(2) = 3e-12 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 294 HCPICYE 274 HCPICYE Sbjct: 152 HCPICYE 158 >ref|XP_003593984.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] gi|355483032|gb|AES64235.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] Length = 267 Score = 72.8 bits (177), Expect(2) = 3e-12 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 179 QYLFDSLKDTTIMKCGHTMHCECFHEMIKRDK 84 +YLFDSLKDTT+MKCGHTMHCEC+HEMIKRDK Sbjct: 158 EYLFDSLKDTTVMKCGHTMHCECYHEMIKRDK 189 Score = 23.5 bits (49), Expect(2) = 3e-12 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 294 HCPICYE 274 HCPICYE Sbjct: 152 HCPICYE 158 >gb|AEX97080.1| zinc-finger protein [Malus x domestica] Length = 267 Score = 65.9 bits (159), Expect(2) = 3e-10 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = -3 Query: 179 QYLFDSLKDTTIMKCGHTMHCECFHEMIKRDK 84 ++LFDSLK+TT+MKCGHTMHCEC++EM+KRDK Sbjct: 158 EFLFDSLKETTVMKCGHTMHCECYNEMMKRDK 189 Score = 23.5 bits (49), Expect(2) = 3e-10 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 294 HCPICYE 274 HCPICYE Sbjct: 152 HCPICYE 158 >gb|AFK36462.1| unknown [Lotus japonicus] Length = 267 Score = 65.1 bits (157), Expect(2) = 5e-10 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 179 QYLFDSLKDTTIMKCGHTMHCECFHEMIKRD 87 +YLFDSLKDT +MKCGHTMH EC+HEMIKRD Sbjct: 158 EYLFDSLKDTAVMKCGHTMHSECYHEMIKRD 188 Score = 23.5 bits (49), Expect(2) = 5e-10 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 294 HCPICYE 274 HCPICYE Sbjct: 152 HCPICYE 158 >ref|XP_002516875.1| zinc finger protein, putative [Ricinus communis] gi|223543963|gb|EEF45489.1| zinc finger protein, putative [Ricinus communis] Length = 269 Score = 64.3 bits (155), Expect(2) = 9e-10 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 179 QYLFDSLKDTTIMKCGHTMHCECFHEMIKRDK 84 +YLFDSLKDTT+MKCGHTMH EC++EMI+RDK Sbjct: 160 EYLFDSLKDTTVMKCGHTMHFECYNEMIERDK 191 Score = 23.5 bits (49), Expect(2) = 9e-10 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 294 HCPICYE 274 HCPICYE Sbjct: 154 HCPICYE 160