BLASTX nr result
ID: Atractylodes22_contig00035041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00035041 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 60 2e-07 ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808... 55 4e-06 ref|XP_003636545.1| Pentatricopeptide repeat-containing protein ... 55 6e-06 gb|ABN08405.1| Peptidase aspartic, active site [Medicago truncat... 55 6e-06 gb|ABN08407.1| Peptidase aspartic, active site [Medicago truncat... 55 6e-06 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/67 (47%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Frame = +2 Query: 245 GSGNQGRSQINSDV--NGPNQNRNRGFRSLSRTEWEERRRKGLCFRCGQIFSPAHKCPEG 418 G G +G Q D +GP R+R F LS E ER++KGLCF+CG F P H+CP+ Sbjct: 73 GFGPKGEKQAQYDKKKSGP---RDRSFTHLSYNELMERKQKGLCFKCGGPFHPMHQCPDK 129 Query: 419 DLRVLLL 439 LRVL+L Sbjct: 130 QLRVLVL 136 >ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808652 [Glycine max] Length = 463 Score = 55.5 bits (132), Expect = 4e-06 Identities = 29/67 (43%), Positives = 40/67 (59%), Gaps = 1/67 (1%) Frame = +2 Query: 242 AGSGNQGRSQINSDVNGPNQNRNRGFRSLSRTEWEERRRKGLCFRCGQIFSPA-HKCPEG 418 A +G +G + + V+ + +G RS+ E ERR KGLCF+CG + P HKCPE Sbjct: 278 ASTGRKGETDTRTGVS----EKWKGVRSIRNNEMAERRAKGLCFKCGGKYHPTLHKCPER 333 Query: 419 DLRVLLL 439 LRVL+L Sbjct: 334 ALRVLIL 340 >ref|XP_003636545.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502480|gb|AES83683.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1280 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/51 (52%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = +2 Query: 290 GPNQNRNRGFRSLSRTEWEERRRKGLCFRCGQIFSPA-HKCPEGDLRVLLL 439 G R +G RS+ E ERR KGLCF+CG + P HKCPE LRVL+L Sbjct: 915 GDRVERWKGVRSIQNGEMAERRAKGLCFKCGGKYHPTLHKCPEKSLRVLIL 965 >gb|ABN08405.1| Peptidase aspartic, active site [Medicago truncatula] Length = 435 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 5/72 (6%) Frame = +2 Query: 239 DAGSGNQGRSQINSDVNGPNQN-----RNRGFRSLSRTEWEERRRKGLCFRCGQIFSPAH 403 ++G N+ R N N + R++ RSLS E +RR+KGLCF+CG + P H Sbjct: 16 NSGGNNRARGMFNVGQNKTHTINTANWRDKNVRSLSSQEIADRRQKGLCFKCGGPYHPRH 75 Query: 404 KCPEGDLRVLLL 439 +CP+ +L V++L Sbjct: 76 QCPDKNLSVMVL 87 >gb|ABN08407.1| Peptidase aspartic, active site [Medicago truncatula] Length = 435 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 5/72 (6%) Frame = +2 Query: 239 DAGSGNQGRSQINSDVNGPNQN-----RNRGFRSLSRTEWEERRRKGLCFRCGQIFSPAH 403 ++G N+ R N N + R++ RSLS E +RR+KGLCF+CG + P H Sbjct: 16 NSGGNNRAREMFNVGQNKTHTINTANWRDKNVRSLSSQEIADRRQKGLCFKCGGPYHPRH 75 Query: 404 KCPEGDLRVLLL 439 +CP+ +L V++L Sbjct: 76 QCPDKNLSVMVL 87