BLASTX nr result
ID: Atractylodes22_contig00034939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00034939 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530259.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002530259.1| conserved hypothetical protein [Ricinus communis] gi|223530225|gb|EEF32129.1| conserved hypothetical protein [Ricinus communis] Length = 524 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = +3 Query: 144 MANSKYEYVKSFE--NEVMYPKHSIVVRIDGHNFARFSEINE 263 MANSKYEYVKS+E +EVM P + IVVRIDGH+F RFS+++E Sbjct: 1 MANSKYEYVKSYEVEDEVMLP-NIIVVRIDGHDFRRFSKVHE 41