BLASTX nr result
ID: Atractylodes22_contig00034475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00034475 (835 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526135.1| hypothetical protein RCOM_0137170 [Ricinus c... 76 8e-12 ref|XP_002307485.1| predicted protein [Populus trichocarpa] gi|2... 72 1e-10 gb|AAF63102.1|AC006423_3 Hypothetical protein [Arabidopsis thali... 68 2e-09 ref|NP_175045.2| RING/FYVE/PHD zinc finger-containing protein [A... 68 2e-09 ref|NP_001117432.1| RING/FYVE/PHD zinc finger-containing protein... 68 2e-09 >ref|XP_002526135.1| hypothetical protein RCOM_0137170 [Ricinus communis] gi|223534512|gb|EEF36211.1| hypothetical protein RCOM_0137170 [Ricinus communis] Length = 366 Score = 76.3 bits (186), Expect = 8e-12 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = -2 Query: 597 VLVCQTCGDEGFTNAFVYCVKCLRFVVHRYCLDVIPRTFDEFVPWFCEACKRV 439 V +CQTCGD GF+NA ++C +C + VH YCL ++P TFDE+V W CE C+ + Sbjct: 2 VTICQTCGDGGFSNALIFCDECQVYAVHCYCLAILPATFDEYVLWLCEDCESI 54 >ref|XP_002307485.1| predicted protein [Populus trichocarpa] gi|222856934|gb|EEE94481.1| predicted protein [Populus trichocarpa] Length = 456 Score = 72.4 bits (176), Expect = 1e-10 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = -2 Query: 600 KVLVCQTCGDEGFTNAFVYCVKCLRFVVHRYCLDVIPRTFDEFVPWFCEACK 445 +V +CQ CGD GF A ++C +C + VH YCLDV+P TFDE+V W C C+ Sbjct: 6 QVTICQKCGDRGFDAALIFCDECQAYAVHCYCLDVLPATFDEYVVWLCYHCE 57 >gb|AAF63102.1|AC006423_3 Hypothetical protein [Arabidopsis thaliana] Length = 419 Score = 68.2 bits (165), Expect = 2e-09 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = -2 Query: 615 LNYHDKVLVCQTCGDEGFTNAFVYCVKCLRFVVHRYCLDVIPRTFDEFVPWFCEAC 448 ++ H K VCQTCGD GF A V+C C+ +HRYCL + P F E++ W CE C Sbjct: 1 MSLHVKGPVCQTCGDIGFEEALVFCDSCMFESIHRYCLGITPIPFTEYITWICEDC 56 >ref|NP_175045.2| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|332193873|gb|AEE31994.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] Length = 371 Score = 68.2 bits (165), Expect = 2e-09 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = -2 Query: 615 LNYHDKVLVCQTCGDEGFTNAFVYCVKCLRFVVHRYCLDVIPRTFDEFVPWFCEAC 448 ++ H K VCQTCGD GF A V+C C+ +HRYCL + P F E++ W CE C Sbjct: 1 MSLHVKGPVCQTCGDIGFEEALVFCDSCMFESIHRYCLGITPIPFTEYITWICEDC 56 >ref|NP_001117432.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|225898006|dbj|BAH30335.1| hypothetical protein [Arabidopsis thaliana] gi|332193874|gb|AEE31995.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] Length = 431 Score = 68.2 bits (165), Expect = 2e-09 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = -2 Query: 615 LNYHDKVLVCQTCGDEGFTNAFVYCVKCLRFVVHRYCLDVIPRTFDEFVPWFCEAC 448 ++ H K VCQTCGD GF A V+C C+ +HRYCL + P F E++ W CE C Sbjct: 1 MSLHVKGPVCQTCGDIGFEEALVFCDSCMFESIHRYCLGITPIPFTEYITWICEDC 56