BLASTX nr result
ID: Atractylodes22_contig00034446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00034446 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278429.1| PREDICTED: protein phosphatase 2C 29-like [V... 63 2e-08 emb|CBI33901.3| unnamed protein product [Vitis vinifera] 59 3e-07 >ref|XP_002278429.1| PREDICTED: protein phosphatase 2C 29-like [Vitis vinifera] Length = 822 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -1 Query: 127 NVMGGGFSHLLPCFNPAEKRRGESPELIFTATEPLDETLGHS 2 NVMG G S L PCF PA + E PE++FTA+EPLDETLGHS Sbjct: 52 NVMGSGLSQLCPCFVPASRTAVEEPEVVFTASEPLDETLGHS 93 >emb|CBI33901.3| unnamed protein product [Vitis vinifera] Length = 754 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -1 Query: 121 MGGGFSHLLPCFNPAEKRRGESPELIFTATEPLDETLGHS 2 MG G S L PCF PA + E PE++FTA+EPLDETLGHS Sbjct: 1 MGSGLSQLCPCFVPASRTAVEEPEVVFTASEPLDETLGHS 40