BLASTX nr result
ID: Atractylodes22_contig00034291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00034291 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004162385.1| PREDICTED: uncharacterized protein LOC101229... 60 2e-07 ref|XP_004140606.1| PREDICTED: uncharacterized protein LOC101214... 60 2e-07 emb|CBI39386.3| unnamed protein product [Vitis vinifera] 59 5e-07 >ref|XP_004162385.1| PREDICTED: uncharacterized protein LOC101229159 [Cucumis sativus] Length = 749 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 92 NFRNGILKRTPRGCRGICNCLNCTSFRLHA 3 N R GILKR+ RGCRGICNCLNC+SFRLHA Sbjct: 615 NHRKGILKRSTRGCRGICNCLNCSSFRLHA 644 >ref|XP_004140606.1| PREDICTED: uncharacterized protein LOC101214238 [Cucumis sativus] Length = 749 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 92 NFRNGILKRTPRGCRGICNCLNCTSFRLHA 3 N R GILKR+ RGCRGICNCLNC+SFRLHA Sbjct: 615 NHRKGILKRSTRGCRGICNCLNCSSFRLHA 644 >emb|CBI39386.3| unnamed protein product [Vitis vinifera] Length = 464 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -3 Query: 134 LQVVPLNSRGLFGENFRNGILKRTPRGCRGICNCLNCTSFRLHA 3 LQV G + GILKR PRGCRG+C+CLNC SFRLHA Sbjct: 313 LQVEAFAPSGFPDARLQKGILKRNPRGCRGLCSCLNCASFRLHA 356