BLASTX nr result
ID: Atractylodes22_contig00034212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00034212 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB51379.1| apocytochrome b [Nicotiana tabacum] 108 3e-22 sp|P29757.4|CYB_SOLTU RecName: Full=Cytochrome b; AltName: Full=... 108 3e-22 dbj|BAD83429.2| apocytochrome b (mitochondrion) [Nicotiana tabacum] 108 3e-22 gb|AEP32429.1| apocytochrome b (mitochondrion) [Silene vulgaris] 108 6e-22 ref|YP_003875502.1| apocytochrome b [Silene latifolia] gi|296040... 108 6e-22 >gb|AAB51379.1| apocytochrome b [Nicotiana tabacum] Length = 393 Score = 108 bits (271), Expect = 3e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 204 IRNQRLSILKQPIFSILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF 362 IRNQRLS+LKQPI SILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF Sbjct: 3 IRNQRLSLLKQPISSILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF 55 >sp|P29757.4|CYB_SOLTU RecName: Full=Cytochrome b; AltName: Full=Complex III subunit 3; AltName: Full=Complex III subunit III; AltName: Full=Cytochrome b-c1 complex subunit 3; AltName: Full=Ubiquinol-cytochrome-c reductase complex cytochrome b subunit Length = 393 Score = 108 bits (271), Expect = 3e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 204 IRNQRLSILKQPIFSILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF 362 IRNQRLS+LKQPI SILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF Sbjct: 3 IRNQRLSLLKQPISSILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF 55 >dbj|BAD83429.2| apocytochrome b (mitochondrion) [Nicotiana tabacum] Length = 393 Score = 108 bits (271), Expect = 3e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 204 IRNQRLSILKQPIFSILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF 362 IRNQRLS+LKQPI SILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF Sbjct: 3 IRNQRLSLLKQPISSILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF 55 >gb|AEP32429.1| apocytochrome b (mitochondrion) [Silene vulgaris] Length = 400 Score = 108 bits (269), Expect = 6e-22 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = +3 Query: 204 IRNQRLSILKQPIFSILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF 362 +RNQR S+LKQPIFS LNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF Sbjct: 3 LRNQRFSVLKQPIFSTLNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF 55 >ref|YP_003875502.1| apocytochrome b [Silene latifolia] gi|296040669|gb|ADG85302.1| apocytochrome b [Silene latifolia] gi|301338023|gb|ADK73315.1| apocytochrome b [Silene latifolia] Length = 393 Score = 108 bits (269), Expect = 6e-22 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = +3 Query: 204 IRNQRLSILKQPIFSILNQHLIDYPTPSNLSYWWGFGSLAGICLVIQIVTGVF 362 IRNQR S+LKQPIFS LNQHLIDYPTPSN+SYWWGFGSLAGICLVIQIVTGVF Sbjct: 3 IRNQRFSVLKQPIFSTLNQHLIDYPTPSNISYWWGFGSLAGICLVIQIVTGVF 55