BLASTX nr result
ID: Atractylodes22_contig00034207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00034207 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533687.1| zinc finger protein, putative [Ricinus commu... 65 6e-09 ref|XP_002331677.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_002324491.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_002277953.1| PREDICTED: zinc finger protein CONSTANS-LIKE... 63 3e-08 gb|AAM65968.1| CONSTANS-like B-box zinc finger protein-like [Ara... 61 1e-07 >ref|XP_002533687.1| zinc finger protein, putative [Ricinus communis] gi|223526413|gb|EEF28695.1| zinc finger protein, putative [Ricinus communis] Length = 388 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 83 KCFPTGWNVAVRLCDSCKSAAALLFCRKDSAFLCMACDVKLH 208 K GW VA R CDSCK+AAA +FCR DSAFLC+ CD K+H Sbjct: 9 KSLTGGWTVAARRCDSCKTAAAAVFCRADSAFLCLNCDAKIH 50 >ref|XP_002331677.1| predicted protein [Populus trichocarpa] gi|222874096|gb|EEF11227.1| predicted protein [Populus trichocarpa] Length = 339 Score = 63.2 bits (152), Expect = 2e-08 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +2 Query: 98 GWNVAVRLCDSCKSAAALLFCRKDSAFLCMACDVKLH 208 GW+VA + CDSCK+AAA FCR DSAFLC+ CD K+H Sbjct: 14 GWSVAAKRCDSCKTAAAAAFCRADSAFLCLNCDTKIH 50 >ref|XP_002324491.1| predicted protein [Populus trichocarpa] gi|222865925|gb|EEF03056.1| predicted protein [Populus trichocarpa] Length = 362 Score = 63.2 bits (152), Expect = 2e-08 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +2 Query: 98 GWNVAVRLCDSCKSAAALLFCRKDSAFLCMACDVKLH 208 GW+VA + CDSCK+AAA FCR DSAFLC+ CD K+H Sbjct: 14 GWSVAAKRCDSCKTAAAAAFCRADSAFLCLNCDTKIH 50 >ref|XP_002277953.1| PREDICTED: zinc finger protein CONSTANS-LIKE 5-like [Vitis vinifera] Length = 361 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 101 WNVAVRLCDSCKSAAALLFCRKDSAFLCMACDVKLH 208 W +A + CDSCKSAAALLFCR DSAFLC+ CD K+H Sbjct: 16 WALAAKPCDSCKSAAALLFCRADSAFLCVGCDSKIH 51 >gb|AAM65968.1| CONSTANS-like B-box zinc finger protein-like [Arabidopsis thaliana] Length = 355 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = +2 Query: 83 KCFPTGWNVAVRLCDSCKSAAALLFCRKDSAFLCMACDVKLH 208 K GW A R CD+CKS A +FCR DSAFLC+ACD ++H Sbjct: 9 KSISGGWGAAARSCDACKSVTAAVFCRVDSAFLCIACDTRIH 50