BLASTX nr result
ID: Atractylodes22_contig00034060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00034060 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI33036.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_002533140.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 tpg|DAA44026.1| TPA: hypothetical protein ZEAMMB73_656538, parti... 55 4e-06 tpg|DAA44025.1| TPA: hypothetical protein ZEAMMB73_656538 [Zea m... 55 4e-06 ref|XP_002465712.1| hypothetical protein SORBIDRAFT_01g044370 [S... 55 4e-06 >emb|CBI33036.3| unnamed protein product [Vitis vinifera] Length = 409 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 313 RMYKNGYVWNDLGENDVICPPEGDEYVLKASQLV 212 R YKNGYVWNDL END+I P EG EYVLK S+L+ Sbjct: 86 RSYKNGYVWNDLAENDIIYPAEGAEYVLKGSELI 119 >ref|XP_002533140.1| conserved hypothetical protein [Ricinus communis] gi|223527068|gb|EEF29252.1| conserved hypothetical protein [Ricinus communis] Length = 427 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 313 RMYKNGYVWNDLGENDVICPPEGDEYVLKASQLV 212 R YKNGYVWNDL END+I P +G EYVLK S+LV Sbjct: 88 RSYKNGYVWNDLAENDIIYPSDGAEYVLKGSELV 121 >tpg|DAA44026.1| TPA: hypothetical protein ZEAMMB73_656538, partial [Zea mays] Length = 190 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 313 RMYKNGYVWNDLGENDVICPPEGDEYVLKASQL 215 R YKNGYVWNDL ENDVI P +G EYVLK S++ Sbjct: 95 RNYKNGYVWNDLSENDVIYPSDGVEYVLKGSEI 127 >tpg|DAA44025.1| TPA: hypothetical protein ZEAMMB73_656538 [Zea mays] Length = 411 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 313 RMYKNGYVWNDLGENDVICPPEGDEYVLKASQL 215 R YKNGYVWNDL ENDVI P +G EYVLK S++ Sbjct: 95 RNYKNGYVWNDLSENDVIYPSDGVEYVLKGSEI 127 >ref|XP_002465712.1| hypothetical protein SORBIDRAFT_01g044370 [Sorghum bicolor] gi|241919566|gb|EER92710.1| hypothetical protein SORBIDRAFT_01g044370 [Sorghum bicolor] Length = 413 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 313 RMYKNGYVWNDLGENDVICPPEGDEYVLKASQL 215 R YKNGYVWNDL ENDVI P +G EYVLK S++ Sbjct: 98 RNYKNGYVWNDLSENDVIYPSDGVEYVLKGSEI 130