BLASTX nr result
ID: Atractylodes22_contig00033843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033843 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621657.1| Histone-lysine N-methyltransferase ATX2, par... 55 6e-06 >ref|XP_003621657.1| Histone-lysine N-methyltransferase ATX2, partial [Medicago truncatula] gi|355496672|gb|AES77875.1| Histone-lysine N-methyltransferase ATX2, partial [Medicago truncatula] Length = 555 Score = 55.5 bits (132), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 295 RYVPLDLVYSATSPCSGYSNVMSKKVKARK 384 RY+PLD +YSATSPCSG SNVMSKKVKARK Sbjct: 28 RYLPLDHLYSATSPCSGSSNVMSKKVKARK 57