BLASTX nr result
ID: Atractylodes22_contig00033810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033810 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270546.2| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 59 5e-07 ref|XP_002300357.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 emb|CAN64008.1| hypothetical protein VITISV_000279 [Vitis vinifera] 59 5e-07 ref|XP_004138984.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_002270546.2| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Vitis vinifera] Length = 509 Score = 58.5 bits (140), Expect = 5e-07 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = +3 Query: 117 KLDSVLSLLKRRDGDFDVASGSLESSLDDMNLNMSEEFVVRVLETPHVPGENLI 278 KL+SVLSLL+ GD A GSLESS + M L+++EEFVVRVLETP VP NLI Sbjct: 119 KLESVLSLLQS-SGD---AVGSLESSFNAMGLSLNEEFVVRVLETPFVPANNLI 168 >ref|XP_002300357.1| predicted protein [Populus trichocarpa] gi|222847615|gb|EEE85162.1| predicted protein [Populus trichocarpa] Length = 476 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +3 Query: 117 KLDSVLSLLKRRDGDFDVASGSLESSLDDMNLNMSEEFVVRVLETPHVPGENLI 278 KL++VL LL+ D GSLES+LD +L++ EEFVV+VLETPHV GENLI Sbjct: 31 KLENVLHLLQSSD------DGSLESTLDTFSLDLHEEFVVKVLETPHVLGENLI 78 >emb|CAN64008.1| hypothetical protein VITISV_000279 [Vitis vinifera] Length = 549 Score = 58.5 bits (140), Expect = 5e-07 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = +3 Query: 117 KLDSVLSLLKRRDGDFDVASGSLESSLDDMNLNMSEEFVVRVLETPHVPGENLI 278 KL+SVLSLL+ GD A GSLESS + M L+++EEFVVRVLETP VP NLI Sbjct: 119 KLESVLSLLQS-SGD---AVGSLESSFNAMGLSLNEEFVVRVLETPFVPANNLI 168 >ref|XP_004138984.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Cucumis sativus] gi|449477884|ref|XP_004155152.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Cucumis sativus] Length = 479 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/54 (51%), Positives = 40/54 (74%) Frame = +3 Query: 117 KLDSVLSLLKRRDGDFDVASGSLESSLDDMNLNMSEEFVVRVLETPHVPGENLI 278 +L+SVLSL++ GS ESSLD+M L ++E+FV++V+ETPH+ GENLI Sbjct: 33 QLESVLSLIQ------STVDGSFESSLDEMRLTLNEDFVLKVIETPHILGENLI 80