BLASTX nr result
ID: Atractylodes22_contig00033586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033586 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 63 2e-08 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 63.2 bits (152), Expect = 2e-08 Identities = 33/74 (44%), Positives = 44/74 (59%) Frame = +3 Query: 9 QRLVKWKGRSSDDVTWVDEEVFRSQFPDFSLEDKAVVKEPGSVRSPESEAQPEVQPIVTQ 188 Q LV W G+ ++ TW D + RSQFP+F LEDKA++ VR+ ES +V Sbjct: 1225 QVLVHWMGQKVEEATWEDTLIIRSQFPNFYLEDKAMLSGGSIVRTAES--------LVHN 1276 Query: 189 STSKPNVWRVYSRR 230 +T P VW+VYSRR Sbjct: 1277 TTVGPKVWQVYSRR 1290