BLASTX nr result
ID: Atractylodes22_contig00033585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033585 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003636545.1| Pentatricopeptide repeat-containing protein ... 71 1e-10 gb|ABN08404.1| Retrotransposon gag protein [Medicago truncatula]... 70 1e-10 ref|XP_003533374.1| PREDICTED: uncharacterized protein LOC100812... 70 2e-10 ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808... 61 1e-07 >ref|XP_003636545.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502480|gb|AES83683.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1280 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/43 (69%), Positives = 40/43 (93%) Frame = -1 Query: 131 EYRMAVKKVELPMFDGDDPVGWITRAEIYFEVQNSPEEIKVKL 3 E R+A KKV+LP+F+GDDPV WITRAEIYF+VQN+P++++VKL Sbjct: 739 ESRLAGKKVKLPLFEGDDPVAWITRAEIYFDVQNTPDDMRVKL 781 >gb|ABN08404.1| Retrotransposon gag protein [Medicago truncatula] gi|124360393|gb|ABN08406.1| Retrotransposon gag protein [Medicago truncatula] Length = 224 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -1 Query: 146 DDRMAEYRMAVKKVELPMFDGDDPVGWITRAEIYFEVQNSPEEIKVKL 3 D+ + E+R++VKKVEL MF+GDDP GWI RAE+YF VQN+ EIKV L Sbjct: 71 DEALDEFRLSVKKVELLMFNGDDPAGWIARAEVYFNVQNTTPEIKVNL 118 >ref|XP_003533374.1| PREDICTED: uncharacterized protein LOC100812827 [Glycine max] Length = 572 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/48 (62%), Positives = 41/48 (85%) Frame = -1 Query: 146 DDRMAEYRMAVKKVELPMFDGDDPVGWITRAEIYFEVQNSPEEIKVKL 3 D +E R+A KKV+LP+FDGDDPV WITRAEIYF+VQ++ ++++VKL Sbjct: 61 DSAQSESRLAGKKVKLPLFDGDDPVAWITRAEIYFDVQDTSDDMRVKL 108 >ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808652 [Glycine max] Length = 463 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/43 (60%), Positives = 37/43 (86%) Frame = -1 Query: 131 EYRMAVKKVELPMFDGDDPVGWITRAEIYFEVQNSPEEIKVKL 3 E R++ KKV+LP+F+GDD V WITR EIYF+VQN+ ++++VKL Sbjct: 49 ESRLSGKKVKLPLFEGDDLVAWITRVEIYFDVQNTTDKMRVKL 91