BLASTX nr result
ID: Atractylodes22_contig00033568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033568 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28722.3| unnamed protein product [Vitis vinifera] 173 1e-41 ref|XP_003632339.1| PREDICTED: pentatricopeptide repeat-containi... 173 1e-41 ref|XP_002306785.1| predicted protein [Populus trichocarpa] gi|2... 167 6e-40 ref|XP_004146992.1| PREDICTED: pentatricopeptide repeat-containi... 166 2e-39 ref|XP_002524751.1| pentatricopeptide repeat-containing protein,... 163 1e-38 >emb|CBI28722.3| unnamed protein product [Vitis vinifera] Length = 1361 Score = 173 bits (439), Expect = 1e-41 Identities = 83/101 (82%), Positives = 88/101 (87%) Frame = -2 Query: 386 EVTELWGEMKVLAFYHGMKFDQELLDSVLYTFVRGGFFIRANEVVEMMEKGKMFVDKYKY 207 EVTELWGEMK A MKFDQELLD+VLYTFVRGGFF+RANEVVEMME+GKMF+DKYKY Sbjct: 1261 EVTELWGEMKSFASSSSMKFDQELLDAVLYTFVRGGFFVRANEVVEMMERGKMFIDKYKY 1320 Query: 206 RTLFLKYHKTFCKGKAPKFQTESQLNRRDAALTFKKWVGLF 84 RTLFLKYHKT K K PK QTE+Q RRDAALTFKKWVGLF Sbjct: 1321 RTLFLKYHKTLYKSKPPKVQTEAQFRRRDAALTFKKWVGLF 1361 >ref|XP_003632339.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Vitis vinifera] Length = 784 Score = 173 bits (439), Expect = 1e-41 Identities = 83/101 (82%), Positives = 88/101 (87%) Frame = -2 Query: 386 EVTELWGEMKVLAFYHGMKFDQELLDSVLYTFVRGGFFIRANEVVEMMEKGKMFVDKYKY 207 EVTELWGEMK A MKFDQELLD+VLYTFVRGGFF+RANEVVEMME+GKMF+DKYKY Sbjct: 684 EVTELWGEMKSFASSSSMKFDQELLDAVLYTFVRGGFFVRANEVVEMMERGKMFIDKYKY 743 Query: 206 RTLFLKYHKTFCKGKAPKFQTESQLNRRDAALTFKKWVGLF 84 RTLFLKYHKT K K PK QTE+Q RRDAALTFKKWVGLF Sbjct: 744 RTLFLKYHKTLYKSKPPKVQTEAQFRRRDAALTFKKWVGLF 784 >ref|XP_002306785.1| predicted protein [Populus trichocarpa] gi|222856234|gb|EEE93781.1| predicted protein [Populus trichocarpa] Length = 750 Score = 167 bits (424), Expect = 6e-40 Identities = 80/100 (80%), Positives = 88/100 (88%) Frame = -2 Query: 386 EVTELWGEMKVLAFYHGMKFDQELLDSVLYTFVRGGFFIRANEVVEMMEKGKMFVDKYKY 207 EVTELWGEMK +A MKFDQELLDSVLYTFVRGGFF RANEVV+MMEKGKMF+DKYKY Sbjct: 650 EVTELWGEMKSIASATSMKFDQELLDSVLYTFVRGGFFSRANEVVDMMEKGKMFIDKYKY 709 Query: 206 RTLFLKYHKTFCKGKAPKFQTESQLNRRDAALTFKKWVGL 87 RTL+LKYHKT KGK PK QTES + +R+AALTFKKW+GL Sbjct: 710 RTLYLKYHKTLYKGKTPKIQTESLVKKREAALTFKKWLGL 749 >ref|XP_004146992.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Cucumis sativus] gi|449503826|ref|XP_004162196.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like [Cucumis sativus] Length = 796 Score = 166 bits (419), Expect = 2e-39 Identities = 79/100 (79%), Positives = 87/100 (87%) Frame = -2 Query: 386 EVTELWGEMKVLAFYHGMKFDQELLDSVLYTFVRGGFFIRANEVVEMMEKGKMFVDKYKY 207 EVTELWGEMK +A +KFDQELLDSVLYTFVRGGFF RANEVVE+MEK KMF+DKYKY Sbjct: 696 EVTELWGEMKSIASASFLKFDQELLDSVLYTFVRGGFFARANEVVEVMEKDKMFIDKYKY 755 Query: 206 RTLFLKYHKTFCKGKAPKFQTESQLNRRDAALTFKKWVGL 87 RTLFLKYH+T KGKAPKFQTE+QL +R+ L FKKWVGL Sbjct: 756 RTLFLKYHRTLYKGKAPKFQTEAQLRKRETTLAFKKWVGL 795 >ref|XP_002524751.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535935|gb|EEF37594.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 787 Score = 163 bits (413), Expect = 1e-38 Identities = 79/100 (79%), Positives = 87/100 (87%) Frame = -2 Query: 386 EVTELWGEMKVLAFYHGMKFDQELLDSVLYTFVRGGFFIRANEVVEMMEKGKMFVDKYKY 207 EVTELWGEMK +A MKFDQELLDSVLYTFVRGGFF RANEVV MMEK +MF+DKYKY Sbjct: 687 EVTELWGEMKSIASATSMKFDQELLDSVLYTFVRGGFFSRANEVVAMMEKVEMFIDKYKY 746 Query: 206 RTLFLKYHKTFCKGKAPKFQTESQLNRRDAALTFKKWVGL 87 RTLFLKYHKT KGK+PK QTE+Q +R+AAL+FKKWVGL Sbjct: 747 RTLFLKYHKTLYKGKSPKIQTEAQARKREAALSFKKWVGL 786