BLASTX nr result
ID: Atractylodes22_contig00033541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033541 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138695.1| PREDICTED: U2 snRNP-associated SURP motif-co... 60 1e-07 ref|XP_003628951.1| U2-associated protein SR140 [Medicago trunca... 60 1e-07 emb|CBI21155.3| unnamed protein product [Vitis vinifera] 60 1e-07 ref|XP_002515412.1| RNA binding protein, putative [Ricinus commu... 60 1e-07 ref|XP_002324341.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 >ref|XP_004138695.1| PREDICTED: U2 snRNP-associated SURP motif-containing protein-like [Cucumis sativus] gi|449493301|ref|XP_004159248.1| PREDICTED: U2 snRNP-associated SURP motif-containing protein-like [Cucumis sativus] Length = 961 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/48 (64%), Positives = 31/48 (64%) Frame = +3 Query: 84 MSSFSITRKKTPFQKHXXXXXXXXXXXXXXXXXLYAEFVESFQGDNAP 227 MSSFSITRKKTPFQKH LYAEFVESFQGDNAP Sbjct: 1 MSSFSITRKKTPFQKHREEEEAKKKREEDETARLYAEFVESFQGDNAP 48 >ref|XP_003628951.1| U2-associated protein SR140 [Medicago truncatula] gi|355522973|gb|AET03427.1| U2-associated protein SR140 [Medicago truncatula] Length = 1139 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/48 (64%), Positives = 31/48 (64%) Frame = +3 Query: 84 MSSFSITRKKTPFQKHXXXXXXXXXXXXXXXXXLYAEFVESFQGDNAP 227 MSSFSITRKKTPFQKH LYAEFVESFQGDNAP Sbjct: 1 MSSFSITRKKTPFQKHREEEEAKKKRAEDETARLYAEFVESFQGDNAP 48 >emb|CBI21155.3| unnamed protein product [Vitis vinifera] Length = 941 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/48 (64%), Positives = 31/48 (64%) Frame = +3 Query: 84 MSSFSITRKKTPFQKHXXXXXXXXXXXXXXXXXLYAEFVESFQGDNAP 227 MSSFSITRKKTPFQKH LYAEFVESFQGDNAP Sbjct: 1 MSSFSITRKKTPFQKHREEEEAKKKRAEDETARLYAEFVESFQGDNAP 48 >ref|XP_002515412.1| RNA binding protein, putative [Ricinus communis] gi|223545356|gb|EEF46861.1| RNA binding protein, putative [Ricinus communis] Length = 979 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/48 (64%), Positives = 31/48 (64%) Frame = +3 Query: 84 MSSFSITRKKTPFQKHXXXXXXXXXXXXXXXXXLYAEFVESFQGDNAP 227 MSSFSITRKKTPFQKH LYAEFVESFQGDNAP Sbjct: 1 MSSFSITRKKTPFQKHREEEEAKKKREDDETARLYAEFVESFQGDNAP 48 >ref|XP_002324341.1| predicted protein [Populus trichocarpa] gi|222865775|gb|EEF02906.1| predicted protein [Populus trichocarpa] Length = 955 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/48 (64%), Positives = 31/48 (64%) Frame = +3 Query: 84 MSSFSITRKKTPFQKHXXXXXXXXXXXXXXXXXLYAEFVESFQGDNAP 227 MSSFSITRKKTPFQKH LYAEFVESFQGDNAP Sbjct: 1 MSSFSITRKKTPFQKHREEEEARKKRAEDETARLYAEFVESFQGDNAP 48