BLASTX nr result
ID: Atractylodes22_contig00033483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033483 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU55782.1| HSP27.8 [Citrullus lanatus] 70 1e-10 ref|XP_002525886.1| small heat-shock protein, putative [Ricinus ... 69 3e-10 ref|XP_002320406.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 gb|ABK95152.1| unknown [Populus trichocarpa] 69 3e-10 ref|XP_003617472.1| Small heat shock protein C4 [Medicago trunca... 69 5e-10 >gb|ADU55782.1| HSP27.8 [Citrullus lanatus] Length = 254 Score = 70.5 bits (171), Expect = 1e-10 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +1 Query: 4 SAYYRREILEGPFEIVWPLPFDVNPDSVSAEFLDGLLRVTIPKL 135 S+Y++REIL+GP+++VWPLP ++N D V AEF DGLLR+T+PKL Sbjct: 211 SSYHKREILQGPYQVVWPLPININKDGVFAEFWDGLLRITLPKL 254 >ref|XP_002525886.1| small heat-shock protein, putative [Ricinus communis] gi|223534800|gb|EEF36490.1| small heat-shock protein, putative [Ricinus communis] Length = 249 Score = 69.3 bits (168), Expect = 3e-10 Identities = 27/44 (61%), Positives = 39/44 (88%) Frame = +1 Query: 4 SAYYRREILEGPFEIVWPLPFDVNPDSVSAEFLDGLLRVTIPKL 135 SAY++REIL+GP+++VWPLP ++N D +SAEFLDG+L + IPK+ Sbjct: 206 SAYHKREILQGPYQVVWPLPSNINKDRISAEFLDGILEIIIPKV 249 >ref|XP_002320406.1| predicted protein [Populus trichocarpa] gi|222861179|gb|EEE98721.1| predicted protein [Populus trichocarpa] Length = 266 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 10 YYRREILEGPFEIVWPLPFDVNPDSVSAEFLDGLLRVTIPKL 135 Y++REI+EGP+EIVW LP D N DSVSAEFL+GLL+VT+PK+ Sbjct: 225 YHKREIVEGPYEIVWQLPLDGNKDSVSAEFLNGLLQVTVPKM 266 >gb|ABK95152.1| unknown [Populus trichocarpa] Length = 267 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 10 YYRREILEGPFEIVWPLPFDVNPDSVSAEFLDGLLRVTIPKL 135 Y++REI+EGP+EIVW LP D N DSVSAEFL+GLL+VT+PK+ Sbjct: 226 YHKREIVEGPYEIVWQLPLDGNKDSVSAEFLNGLLQVTVPKM 267 >ref|XP_003617472.1| Small heat shock protein C4 [Medicago truncatula] gi|355518807|gb|AET00431.1| Small heat shock protein C4 [Medicago truncatula] Length = 259 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = +1 Query: 4 SAYYRREILEGPFEIVWPLPFDVNPDSVSAEFLDGLLRVTIPKL 135 S+Y++REIL GP+E+VWPLP VN D+VSAEFLDG L++ IPK+ Sbjct: 216 SSYHKREILYGPYEVVWPLPHGVNKDNVSAEFLDGFLQIIIPKV 259