BLASTX nr result
ID: Atractylodes22_contig00033450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033450 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD19758.1| putative Ty3-gypsy-like retroelement pol polyprot... 59 3e-09 >gb|AAD19758.1| putative Ty3-gypsy-like retroelement pol polyprotein [Arabidopsis thaliana] Length = 587 Score = 58.9 bits (141), Expect(2) = 3e-09 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 2 QFDNDITIKGRDNVMLFR*GKHKIVMAPVLHFEKPAKKKGENFLM 136 Q+DNDIT +G+DNV++F HKIVMAPV HF++ KK NFL+ Sbjct: 318 QYDNDITYRGKDNVLMFTWNGHKIVMAPVSHFDQNLVKKNSNFLV 362 Score = 27.3 bits (59), Expect(2) = 3e-09 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 138 NERALKEVFEESGNFFPVEVKGLMNAEK 221 +E+ L E +E PV +KGLM+AEK Sbjct: 366 SEKELDEAIKEIECICPVVIKGLMSAEK 393