BLASTX nr result
ID: Atractylodes22_contig00033417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033417 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/52 (53%), Positives = 30/52 (57%) Frame = -3 Query: 198 LTWLARSKFRVGSWYLSEGSGHFEP*MRGNALGWFHRATKTLTS*RWKDYKP 43 + WLARSK RV L EG G P G ALGWFHRA T S +WKD P Sbjct: 1 MIWLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGP 52