BLASTX nr result
ID: Atractylodes22_contig00033269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033269 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA33020.1| oleoyl-acyl carrier protein thioesterase [Cartham... 68 7e-10 gb|AAA33019.1| oleoyl-acyl carrier protein thioesterase [Cartham... 64 1e-08 gb|AAQ08223.1| acyl-ACP thioesterase [Helianthus annuus] gi|3332... 63 2e-08 gb|AAL79361.1| acyl-ACP thioesterase FATA1 [Helianthus annuus] 63 2e-08 >gb|AAA33020.1| oleoyl-acyl carrier protein thioesterase [Carthamus tinctorius] gi|445624|prf||1909371A oleoyl acyl carrier protein thioesterase Length = 389 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 301 KDAEDLSRFLHLLRSSGNGLELNRGRTEWREKPAKR 194 KD DLSRFLHLLRSSG+GLELNRGRTEWR+KPAK+ Sbjct: 354 KDETDLSRFLHLLRSSGDGLELNRGRTEWRKKPAKK 389 >gb|AAA33019.1| oleoyl-acyl carrier protein thioesterase [Carthamus tinctorius] Length = 385 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -1 Query: 301 KDAEDLSRFLHLLRSSGNGLELNRGRTEWREKPAKR 194 KD +DLSRF+HLLRS+G+GLE+NR RTEWR+KPAKR Sbjct: 350 KDEQDLSRFMHLLRSAGSGLEINRCRTEWRKKPAKR 385 >gb|AAQ08223.1| acyl-ACP thioesterase [Helianthus annuus] gi|33325240|gb|AAQ08224.1| acyl-ACP thioesterase, partial [Helianthus annuus] gi|33325242|gb|AAQ08225.1| acyl-ACP thioesterase, partial [Helianthus annuus] gi|33325244|gb|AAQ08226.1| acyl-ACP thioesterase, partial [Helianthus annuus] Length = 365 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 292 EDLSRFLHLLRSSGNGLELNRGRTEWREKPAKR 194 E+LS+FLHLLRSSG GLELNRGRTEWR+KPAK+ Sbjct: 333 ENLSKFLHLLRSSGEGLELNRGRTEWRKKPAKK 365 >gb|AAL79361.1| acyl-ACP thioesterase FATA1 [Helianthus annuus] Length = 365 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 292 EDLSRFLHLLRSSGNGLELNRGRTEWREKPAKR 194 E+LS+FLHLLRSSG GLELNRGRTEWR+KPAK+ Sbjct: 333 ENLSKFLHLLRSSGEGLELNRGRTEWRKKPAKK 365