BLASTX nr result
ID: Atractylodes22_contig00033092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033092 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166077.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 58 9e-07 ref|XP_004146417.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_004166077.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g23020-like [Cucumis sativus] Length = 859 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +2 Query: 2 FKSLGVVLMKRGVSKQAVMNLEVMWKNHYESGLEAWLVTLNSIVGL 139 +KSLGVVL+K GVSKQAV LEV K +SGL+AW+ L+S+VG+ Sbjct: 807 YKSLGVVLLKCGVSKQAVSKLEVTXKKDAQSGLQAWVSVLSSVVGM 852 >ref|XP_004146417.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020-like [Cucumis sativus] Length = 858 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +2 Query: 2 FKSLGVVLMKRGVSKQAVMNLEVMWKNHYESGLEAWLVTLNSIVGL 139 +KSLGVVL+K GVSKQAV LEV K +SGL+AW+ L+S+VG+ Sbjct: 806 YKSLGVVLLKCGVSKQAVSKLEVTAKKDAQSGLQAWVSVLSSVVGM 851