BLASTX nr result
ID: Atractylodes22_contig00033007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033007 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276947.1| PREDICTED: uncharacterized protein LOC100266... 73 3e-11 >ref|XP_002276947.1| PREDICTED: uncharacterized protein LOC100266999 [Vitis vinifera] Length = 1054 Score = 72.8 bits (177), Expect = 3e-11 Identities = 38/75 (50%), Positives = 51/75 (68%) Frame = -3 Query: 231 AFYTEDTPSPVKKKSNAFNDYENLHFEETERNQVGIYNLVNRTDMDQYSESNHVKLENID 52 AFY +D PSPVKK SNAF D E L+++E E VG+ +L + + S+ NH KLENI+ Sbjct: 773 AFYKDDLPSPVKKISNAFKDDETLNYDEMEWATVGLNHLYDSSRPSLSSDINHKKLENIE 832 Query: 51 HLVHQIELLNSTDDE 7 +LV +I LNST +E Sbjct: 833 NLVQRIRELNSTHNE 847