BLASTX nr result
ID: Atractylodes22_contig00032814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00032814 (560 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 63 4e-08 ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 61 1e-07 ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833... 57 4e-07 ref|XP_003564165.1| PREDICTED: uncharacterized protein LOC100843... 52 3e-06 ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840... 55 6e-06 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 62.8 bits (151), Expect = 4e-08 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -3 Query: 420 GMLVIGSTSYDVHRSIKNNETPPSREQIQAMEDYLASKRHGG*P 289 GM+ G+T+YDVHRSIKNNE PP+REQ++A++DY+ SK G P Sbjct: 705 GMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINSKNPRGPP 748 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] gi|355517481|gb|AES99104.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -3 Query: 420 GMLVIGSTSYDVHRSIKNNETPPSREQIQAMEDYLASKR 304 G+L + ST+YDVHRSIKNNETPPS EQ++A+E+Y+ S R Sbjct: 19 GLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVR 57 >ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833743 [Brachypodium distachyon] Length = 58 Score = 57.0 bits (136), Expect(2) = 4e-07 Identities = 22/39 (56%), Positives = 34/39 (87%) Frame = -3 Query: 420 GMLVIGSTSYDVHRSIKNNETPPSREQIQAMEDYLASKR 304 G++ G+T+YDVHRSIKNN+ PP+REQ++A++ Y+ SK+ Sbjct: 19 GLVFFGATTYDVHRSIKNNDQPPTREQMEALQQYIDSKK 57 Score = 22.3 bits (46), Expect(2) = 4e-07 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 473 ILGKQIHPRQIIVFMAG 423 +LGK + RQ+ +F AG Sbjct: 3 LLGKHVSARQVALFAAG 19 >ref|XP_003564165.1| PREDICTED: uncharacterized protein LOC100843543 [Brachypodium distachyon] Length = 83 Score = 51.6 bits (122), Expect(2) = 3e-06 Identities = 20/34 (58%), Positives = 30/34 (88%) Frame = -3 Query: 420 GMLVIGSTSYDVHRSIKNNETPPSREQIQAMEDY 319 G++ G+T+YDVHRSIKNN+ PP+REQ++A++ Y Sbjct: 19 GLVFFGATTYDVHRSIKNNDQPPTREQMEALQVY 52 Score = 24.6 bits (52), Expect(2) = 3e-06 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 470 LGKQIHPRQIIVFMAG 423 LGK + PRQ+ +F AG Sbjct: 4 LGKHVSPRQVALFAAG 19 >ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840032 [Brachypodium distachyon] Length = 58 Score = 55.5 bits (132), Expect = 6e-06 Identities = 21/39 (53%), Positives = 34/39 (87%) Frame = -3 Query: 420 GMLVIGSTSYDVHRSIKNNETPPSREQIQAMEDYLASKR 304 G+++ G T+YDVHRSIKNN+ P +REQ++A+++Y+ SK+ Sbjct: 19 GLMLFGETTYDVHRSIKNNDQPSTREQMEALQEYIDSKK 57