BLASTX nr result
ID: Atractylodes22_contig00032618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00032618 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325990.1| predicted protein [Populus trichocarpa] gi|2... 89 4e-16 ref|XP_002327243.1| predicted protein [Populus trichocarpa] gi|2... 89 4e-16 ref|XP_002874575.1| hypothetical protein ARALYDRAFT_489810 [Arab... 88 8e-16 ref|NP_192696.3| SNARE associated Golgi protein [Arabidopsis tha... 88 8e-16 ref|XP_002271955.1| PREDICTED: uncharacterized membrane protein ... 87 2e-15 >ref|XP_002325990.1| predicted protein [Populus trichocarpa] gi|222862865|gb|EEF00372.1| predicted protein [Populus trichocarpa] Length = 262 Score = 89.0 bits (219), Expect = 4e-16 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +2 Query: 2 ASYITVRAGLALGDLNSVKDLYDLKTLTVLFLIGSISIIPTLLKRKRIYE 151 ASYITVRAGLALGDL SVKDLYD KTL+VLF+IGSISI PTLLKRKRIYE Sbjct: 213 ASYITVRAGLALGDLKSVKDLYDYKTLSVLFIIGSISIFPTLLKRKRIYE 262 >ref|XP_002327243.1| predicted protein [Populus trichocarpa] gi|222835613|gb|EEE74048.1| predicted protein [Populus trichocarpa] Length = 262 Score = 89.0 bits (219), Expect = 4e-16 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +2 Query: 2 ASYITVRAGLALGDLNSVKDLYDLKTLTVLFLIGSISIIPTLLKRKRIYE 151 ASYITV+AGLALGDL SVKDLYD KTL+VLFLIGSISI PTLLKRKRIYE Sbjct: 213 ASYITVKAGLALGDLKSVKDLYDFKTLSVLFLIGSISIFPTLLKRKRIYE 262 >ref|XP_002874575.1| hypothetical protein ARALYDRAFT_489810 [Arabidopsis lyrata subsp. lyrata] gi|297320412|gb|EFH50834.1| hypothetical protein ARALYDRAFT_489810 [Arabidopsis lyrata subsp. lyrata] Length = 294 Score = 87.8 bits (216), Expect = 8e-16 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +2 Query: 2 ASYITVRAGLALGDLNSVKDLYDLKTLTVLFLIGSISIIPTLLKRKRIYE 151 ASYITVRAGLALGDL SVKDLYD KTL+VLFLIGSISI P LLKRKR+YE Sbjct: 245 ASYITVRAGLALGDLRSVKDLYDFKTLSVLFLIGSISIFPALLKRKRVYE 294 >ref|NP_192696.3| SNARE associated Golgi protein [Arabidopsis thaliana] gi|75153817|sp|Q8L586.1|Y4958_ARATH RecName: Full=Uncharacterized membrane protein At4g09580 gi|20465630|gb|AAM20146.1| unknown protein [Arabidopsis thaliana] gi|21281237|gb|AAM45090.1| unknown protein [Arabidopsis thaliana] gi|332657367|gb|AEE82767.1| SNARE associated Golgi protein [Arabidopsis thaliana] Length = 287 Score = 87.8 bits (216), Expect = 8e-16 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +2 Query: 2 ASYITVRAGLALGDLNSVKDLYDLKTLTVLFLIGSISIIPTLLKRKRIYE 151 ASYITVRAGLALGDL SVKDLYD KTL+VLFLIGSISI P LLKRKR+YE Sbjct: 238 ASYITVRAGLALGDLRSVKDLYDFKTLSVLFLIGSISIFPALLKRKRVYE 287 >ref|XP_002271955.1| PREDICTED: uncharacterized membrane protein At4g09580 [Vitis vinifera] gi|296081147|emb|CBI18173.3| unnamed protein product [Vitis vinifera] Length = 279 Score = 86.7 bits (213), Expect = 2e-15 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +2 Query: 2 ASYITVRAGLALGDLNSVKDLYDLKTLTVLFLIGSISIIPTLLKRKRIYE 151 ASYITVRAGLALGDL SVKDLYD KTL+VLFLIG ISI+PTLLKRKR YE Sbjct: 230 ASYITVRAGLALGDLKSVKDLYDFKTLSVLFLIGFISILPTLLKRKRTYE 279