BLASTX nr result
ID: Atractylodes22_contig00032601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00032601 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511570.1| ATP binding protein, putative [Ricinus commu... 60 2e-07 emb|CBI31965.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_002273644.1| PREDICTED: probable methyltransferase PMT2 [... 59 4e-07 tpg|DAA61440.1| TPA: ankyrin protein kinase-like protein [Zea mays] 59 5e-07 ref|XP_003518725.1| PREDICTED: probable methyltransferase PMT2-l... 59 5e-07 >ref|XP_002511570.1| ATP binding protein, putative [Ricinus communis] gi|223550685|gb|EEF52172.1| ATP binding protein, putative [Ricinus communis] Length = 613 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 272 NQDGKYMMEVDRVLRPVGFWVLSGPPINWR 361 + DG YMMEVDRVLRP G+WVLSGPPINWR Sbjct: 282 SNDGMYMMEVDRVLRPGGYWVLSGPPINWR 311 >emb|CBI31965.3| unnamed protein product [Vitis vinifera] Length = 514 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +2 Query: 278 DGKYMMEVDRVLRPVGFWVLSGPPINWR 361 DG YMMEVDRVLRP G+WVLSGPPINWR Sbjct: 183 DGIYMMEVDRVLRPGGYWVLSGPPINWR 210 >ref|XP_002273644.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera] Length = 618 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +2 Query: 278 DGKYMMEVDRVLRPVGFWVLSGPPINWR 361 DG YMMEVDRVLRP G+WVLSGPPINWR Sbjct: 287 DGIYMMEVDRVLRPGGYWVLSGPPINWR 314 >tpg|DAA61440.1| TPA: ankyrin protein kinase-like protein [Zea mays] Length = 615 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 278 DGKYMMEVDRVLRPVGFWVLSGPPINWR 361 DG YMMEVDRVLRP G+WVLSGPPINW+ Sbjct: 286 DGMYMMEVDRVLRPGGYWVLSGPPINWK 313 >ref|XP_003518725.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max] Length = 607 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 278 DGKYMMEVDRVLRPVGFWVLSGPPINWR 361 DG YMMEVDRVLRP G+WVLSGPPINW+ Sbjct: 286 DGMYMMEVDRVLRPGGYWVLSGPPINWK 313