BLASTX nr result
ID: Atractylodes22_contig00032301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00032301 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA73042.1| polyprotein [Ananas comosus] 69 2e-19 emb|CAN80324.1| hypothetical protein VITISV_015014 [Vitis vinifera] 68 3e-19 gb|AAO45752.1| pol protein [Cucumis melo subsp. melo] 69 4e-19 gb|AAP43918.1| integrase [Gossypium hirsutum] 70 7e-19 gb|ABA94145.1| retrotransposon protein, putative, Ty3-gypsy subc... 69 1e-18 >emb|CAA73042.1| polyprotein [Ananas comosus] Length = 871 Score = 68.9 bits (167), Expect(2) = 2e-19 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 18 VIAYASRQLKDHEKKYPTHDLELAAVVFALKIWRH 122 VIAYASRQLK++EK YPTHDLELAAVVFALK+WRH Sbjct: 334 VIAYASRQLKEYEKNYPTHDLELAAVVFALKLWRH 368 Score = 51.6 bits (122), Expect(2) = 2e-19 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 118 GIRYEKYDHTDHKSLKYLFEQKELNMRQKRWMEL 219 G R E Y TDHKSLKYLF QKELN+RQ+RW+EL Sbjct: 372 GERCEVY--TDHKSLKYLFTQKELNLRQRRWLEL 403 >emb|CAN80324.1| hypothetical protein VITISV_015014 [Vitis vinifera] Length = 596 Score = 68.2 bits (165), Expect(2) = 3e-19 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 18 VIAYASRQLKDHEKKYPTHDLELAAVVFALKIWRH 122 V+AYASRQLK +EK YPTHDLELAAVVFALKIWRH Sbjct: 184 VVAYASRQLKPYEKNYPTHDLELAAVVFALKIWRH 218 Score = 51.6 bits (122), Expect(2) = 3e-19 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +1 Query: 145 TDHKSLKYLFEQKELNMRQKRWMEL 219 TDHKSLKYLF QKELNMRQ+RW+EL Sbjct: 229 TDHKSLKYLFSQKELNMRQRRWIEL 253 >gb|AAO45752.1| pol protein [Cucumis melo subsp. melo] Length = 923 Score = 69.3 bits (168), Expect(2) = 4e-19 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 18 VIAYASRQLKDHEKKYPTHDLELAAVVFALKIWRH 122 V+AYASRQLK HE+ YPTHDLELAAVVFALKIWRH Sbjct: 310 VVAYASRQLKSHEQNYPTHDLELAAVVFALKIWRH 344 Score = 50.1 bits (118), Expect(2) = 4e-19 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +1 Query: 145 TDHKSLKYLFEQKELNMRQKRWMEL 219 TDHKSLKY F QKELNMRQ+RW+EL Sbjct: 355 TDHKSLKYFFTQKELNMRQRRWLEL 379 >gb|AAP43918.1| integrase [Gossypium hirsutum] Length = 350 Score = 70.5 bits (171), Expect(2) = 7e-19 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 18 VIAYASRQLKDHEKKYPTHDLELAAVVFALKIWRH 122 V+AYASRQLK HEK YPTHDLELAAVVFALKIWRH Sbjct: 6 VVAYASRQLKPHEKNYPTHDLELAAVVFALKIWRH 40 Score = 48.1 bits (113), Expect(2) = 7e-19 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = +1 Query: 142 HTDHKSLKYLFEQKELNMRQKRWMEL 219 +TDHKSLKYL QK+LN+RQ+RW+EL Sbjct: 50 YTDHKSLKYLMSQKDLNLRQRRWLEL 75 >gb|ABA94145.1| retrotransposon protein, putative, Ty3-gypsy subclass [Oryza sativa Japonica Group] Length = 927 Score = 69.3 bits (168), Expect(2) = 1e-18 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 18 VIAYASRQLKDHEKKYPTHDLELAAVVFALKIWRH 122 VIAYASRQLK HE+ YPTHDLELAAVVFALKIWRH Sbjct: 502 VIAYASRQLKKHEQNYPTHDLELAAVVFALKIWRH 536 Score = 48.5 bits (114), Expect(2) = 1e-18 Identities = 19/25 (76%), Positives = 24/25 (96%) Frame = +1 Query: 145 TDHKSLKYLFEQKELNMRQKRWMEL 219 TDHKSLKY+F QK+LN+RQ+RW+EL Sbjct: 547 TDHKSLKYIFTQKDLNLRQRRWLEL 571