BLASTX nr result
ID: Atractylodes22_contig00032241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00032241 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274158.1| PREDICTED: pentatricopeptide repeat-containi... 118 4e-25 ref|XP_004160754.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 emb|CBI25399.3| unnamed protein product [Vitis vinifera] 99 4e-19 ref|XP_004138557.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 gb|AEB39781.1| pentatricopeptide repeat protein 79 [Funaria hygr... 89 5e-16 >ref|XP_002274158.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Vitis vinifera] Length = 820 Score = 118 bits (296), Expect = 4e-25 Identities = 54/79 (68%), Positives = 65/79 (82%) Frame = -1 Query: 343 YAQIGSSRQGLELRNVMKERGVKKEPGYSWISVRGSVHKFRAQDQEHPEKDKLYFVLDEL 164 Y + GS GL LRNVMK++GVKKEPGYSWISV+G VHKF + DQ+HP+K ++Y L+EL Sbjct: 740 YIETGSYEDGLSLRNVMKDQGVKKEPGYSWISVKGRVHKFYSGDQQHPQKKEIYVKLEEL 799 Query: 163 REKIKAMGYVPDLRYALES 107 REKIKAMGYVPDLRY L + Sbjct: 800 REKIKAMGYVPDLRYVLNN 818 >ref|XP_004160754.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Cucumis sativus] Length = 766 Score = 99.8 bits (247), Expect = 2e-19 Identities = 47/77 (61%), Positives = 60/77 (77%) Frame = -1 Query: 343 YAQIGSSRQGLELRNVMKERGVKKEPGYSWISVRGSVHKFRAQDQEHPEKDKLYFVLDEL 164 Y + GS + GL LR+VMKE+GVKKEPG SWISV G++HKF A DQ+HPEKDK+Y L+EL Sbjct: 690 YIESGSYKDGLSLRHVMKEQGVKKEPGCSWISVNGTLHKFYAGDQQHPEKDKIYAKLEEL 749 Query: 163 REKIKAMGYVPDLRYAL 113 + K+ ++ VPDL Y L Sbjct: 750 KLKLISLDDVPDLSYEL 766 >emb|CBI25399.3| unnamed protein product [Vitis vinifera] Length = 846 Score = 99.0 bits (245), Expect = 4e-19 Identities = 45/67 (67%), Positives = 55/67 (82%) Frame = -1 Query: 343 YAQIGSSRQGLELRNVMKERGVKKEPGYSWISVRGSVHKFRAQDQEHPEKDKLYFVLDEL 164 Y + GS GL LRNVMK++GVKKEPGYSWISV+G VHKF + DQ+HP+K ++Y L+EL Sbjct: 686 YIETGSYEDGLSLRNVMKDQGVKKEPGYSWISVKGRVHKFYSGDQQHPQKKEIYVKLEEL 745 Query: 163 REKIKAM 143 REKIKAM Sbjct: 746 REKIKAM 752 >ref|XP_004138557.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Cucumis sativus] Length = 766 Score = 98.6 bits (244), Expect = 5e-19 Identities = 46/77 (59%), Positives = 60/77 (77%) Frame = -1 Query: 343 YAQIGSSRQGLELRNVMKERGVKKEPGYSWISVRGSVHKFRAQDQEHPEKDKLYFVLDEL 164 Y + GS + GL LR++MKE+GVKKEPG SWISV G++HKF A DQ+HPEKDK+Y L+EL Sbjct: 690 YIESGSYKDGLSLRHLMKEQGVKKEPGCSWISVNGTLHKFYAGDQQHPEKDKIYAKLEEL 749 Query: 163 REKIKAMGYVPDLRYAL 113 + K+ ++ VPDL Y L Sbjct: 750 KLKLISLDDVPDLSYEL 766 >gb|AEB39781.1| pentatricopeptide repeat protein 79 [Funaria hygrometrica] Length = 820 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/77 (53%), Positives = 53/77 (68%) Frame = -1 Query: 343 YAQIGSSRQGLELRNVMKERGVKKEPGYSWISVRGSVHKFRAQDQEHPEKDKLYFVLDEL 164 YA G R +LR +MKERGVKKEPG SWI V G VH F A DQ HP +++Y L+ L Sbjct: 661 YAAAGMWRDVAKLRKLMKERGVKKEPGRSWIEVAGEVHSFVAGDQSHPRTEEIYSELEAL 720 Query: 163 REKIKAMGYVPDLRYAL 113 ++IK++GYVPD R+ + Sbjct: 721 TKQIKSLGYVPDTRFVM 737