BLASTX nr result
ID: Atractylodes22_contig00032083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00032083 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271840.2| PREDICTED: ubiquitin carboxyl-terminal hydro... 59 3e-07 emb|CAN78307.1| hypothetical protein VITISV_005598 [Vitis vinifera] 59 3e-07 >ref|XP_002271840.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Vitis vinifera] Length = 940 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 240 SLDLNWYLQFGITAFAVFFGLIYLVKNTASKYFVVDGD 353 SLDLNW+LQF T+F V GL++LVKNTASKYFVVD + Sbjct: 7 SLDLNWFLQFIFTSFVVALGLLHLVKNTASKYFVVDAN 44 >emb|CAN78307.1| hypothetical protein VITISV_005598 [Vitis vinifera] Length = 494 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 240 SLDLNWYLQFGITAFAVFFGLIYLVKNTASKYFVVDGD 353 SLDLNW+LQF T+F V GL++LVKNTASKYFVVD + Sbjct: 7 SLDLNWFLQFIFTSFVVALGLLHLVKNTASKYFVVDAN 44