BLASTX nr result
ID: Atractylodes22_contig00032010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00032010 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510066.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002510066.1| conserved hypothetical protein [Ricinus communis] gi|223550767|gb|EEF52253.1| conserved hypothetical protein [Ricinus communis] Length = 425 Score = 56.6 bits (135), Expect = 2e-06 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 25/127 (19%) Frame = +3 Query: 3 TPQIVAARTMWMKALQMKMNPGPDLFERNTSHMLDN-----HEDFN---------TTSSD 140 TPQ++ AR +WMK L ++ P D + R+ ++ D HEDF TTS Sbjct: 258 TPQVMEARALWMKELHKQIKPENDWYGRSNTYENDTGNNLLHEDFGYARTYDFEPTTSRA 317 Query: 141 SPQVAEKHPVLKSKEEGSTKAASEQR----------VLPSYTTMPIEDFDDDEDNW-IHE 287 + EKHPV+ + + K+ E++ ++ + +P+ +++DD D+W E Sbjct: 318 TDYETEKHPVVSTDMQFIDKSVIEEKPVIKLENKDLLVGRSSKVPVPNYEDDYDDWPDEE 377 Query: 288 NSELDGY 308 +S+L Y Sbjct: 378 DSDLGSY 384