BLASTX nr result
ID: Atractylodes22_contig00031887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031887 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157334.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 71 1e-10 ref|XP_004143828.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_002274352.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_003520106.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 ref|XP_003614017.1| Pentatricopeptide repeat protein [Medicago t... 67 2e-09 >ref|XP_004157334.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g20540-like [Cucumis sativus] Length = 532 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/57 (52%), Positives = 43/57 (75%) Frame = +2 Query: 11 DSLQRTRKLMKTRGLDKVPGCSSIEVGGIVNEFVAGEKMNHRIQEIHTLLGNLNRQL 181 + +R R +MK +G++KVPGCSSI+V G+VNEF+AGEK + I IH +L LN+Q+ Sbjct: 460 EDAKRVRNMMKLKGVEKVPGCSSIKVNGVVNEFIAGEKTHRHIDNIHLVLEELNKQI 516 >ref|XP_004143828.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Cucumis sativus] Length = 532 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/57 (52%), Positives = 43/57 (75%) Frame = +2 Query: 11 DSLQRTRKLMKTRGLDKVPGCSSIEVGGIVNEFVAGEKMNHRIQEIHTLLGNLNRQL 181 + +R R +MK +G++KVPGCSSI+V G+VNEF+AGEK + I IH +L LN+Q+ Sbjct: 460 EDAKRVRNMMKLKGVEKVPGCSSIKVNGVVNEFIAGEKTHRHIDNIHLVLEELNKQI 516 >ref|XP_002274352.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 536 Score = 69.7 bits (169), Expect = 2e-10 Identities = 26/57 (45%), Positives = 47/57 (82%) Frame = +2 Query: 11 DSLQRTRKLMKTRGLDKVPGCSSIEVGGIVNEFVAGEKMNHRIQEIHTLLGNLNRQL 181 D ++R RK+M+ RG+DK PGCSS+++ G+V+EF+AGE+ + +++E+H +L +N+Q+ Sbjct: 460 DHVRRIRKMMENRGVDKAPGCSSVKINGVVHEFIAGEETHLQMEEVHRVLEKMNKQM 516 >ref|XP_003520106.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Glycine max] Length = 518 Score = 67.4 bits (163), Expect = 1e-09 Identities = 27/55 (49%), Positives = 45/55 (81%) Frame = +2 Query: 20 QRTRKLMKTRGLDKVPGCSSIEVGGIVNEFVAGEKMNHRIQEIHTLLGNLNRQLD 184 +R R +M+ +G+DK PGCSS+E+ G+V+EF+AGE+ + +++EIH++L L+ QLD Sbjct: 464 RRVRNMMRNKGVDKAPGCSSVEIDGVVSEFIAGEETHPQMEEIHSVLEILHMQLD 518 >ref|XP_003614017.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355515352|gb|AES96975.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 525 Score = 66.6 bits (161), Expect = 2e-09 Identities = 26/55 (47%), Positives = 44/55 (80%) Frame = +2 Query: 20 QRTRKLMKTRGLDKVPGCSSIEVGGIVNEFVAGEKMNHRIQEIHTLLGNLNRQLD 184 +R R +MK +G +K PGCSS+E+ G+++EF+AGEK + +++EIH++L ++ QLD Sbjct: 468 RRVRDMMKIKGTNKAPGCSSVEIDGVISEFIAGEKTHPQMEEIHSVLKKMHMQLD 522