BLASTX nr result
ID: Atractylodes22_contig00031733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031733 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154884.1| PREDICTED: double-strand break repair protei... 55 6e-06 >ref|XP_004154884.1| PREDICTED: double-strand break repair protein MRE11-like [Cucumis sativus] Length = 739 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/65 (47%), Positives = 34/65 (52%) Frame = -1 Query: 333 KRAAPRGKGRGSTAAKRGXXXXXXXXXXXXXXXXXXXXXXXXXDVPKRPNKSQPRVTRNY 154 KR APRG+GRGST +KRG + K NKSQPRVTRNY Sbjct: 675 KRTAPRGRGRGSTQSKRGRKSDNSLVQRTFISRDNDDDSEDEDNARKLLNKSQPRVTRNY 734 Query: 153 GALRR 139 GALRR Sbjct: 735 GALRR 739