BLASTX nr result
ID: Atractylodes22_contig00031718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031718 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512310.1| Gibberellin receptor GID1, putative [Ricinus... 60 2e-07 dbj|BAM14053.1| GA Insensitive Dwarf1 B [Lactuca sativa] 59 5e-07 ref|XP_002319576.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 gb|ACN86359.1| GID1-4 [Gossypium hirsutum] 58 7e-07 ref|XP_002328407.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 >ref|XP_002512310.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223548271|gb|EEF49762.1| Gibberellin receptor GID1, putative [Ricinus communis] Length = 344 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 318 YLEKATIGFYLLPNNDHFHTVMDEIHDFVRP 226 YLE+ATIGFYLLPNN+HFHTVMDEI +FV P Sbjct: 312 YLEQATIGFYLLPNNNHFHTVMDEISEFVCP 342 >dbj|BAM14053.1| GA Insensitive Dwarf1 B [Lactuca sativa] Length = 363 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 318 YLEKATIGFYLLPNNDHFHTVMDEIHDFVRPTPDCCWS 205 +LEKATIGFY LPNN+HF+T+M+E+ +FV P+P C S Sbjct: 317 FLEKATIGFYFLPNNEHFYTLMEEMKNFVSPSPVCSLS 354 >ref|XP_002319576.1| predicted protein [Populus trichocarpa] gi|222857952|gb|EEE95499.1| predicted protein [Populus trichocarpa] Length = 344 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 318 YLEKATIGFYLLPNNDHFHTVMDEIHDFVRP 226 YLE+ATIGFYLLPNN+HFHTVM+EI +FV P Sbjct: 312 YLEQATIGFYLLPNNNHFHTVMNEISEFVSP 342 >gb|ACN86359.1| GID1-4 [Gossypium hirsutum] Length = 344 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 318 YLEKATIGFYLLPNNDHFHTVMDEIHDFVRPTPDC 214 Y+E+ATIGFYLLPNN+HFHTVMDEI +FV + DC Sbjct: 312 YMEQATIGFYLLPNNNHFHTVMDEISEFV--SSDC 344 >ref|XP_002328407.1| predicted protein [Populus trichocarpa] gi|222838122|gb|EEE76487.1| predicted protein [Populus trichocarpa] Length = 344 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 318 YLEKATIGFYLLPNNDHFHTVMDEIHDFVRP 226 YLE+ATIGFYLLPNN++FHTVMDEI +FV P Sbjct: 312 YLEQATIGFYLLPNNNYFHTVMDEISEFVSP 342