BLASTX nr result
ID: Atractylodes22_contig00031673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031673 (918 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544457.1| PREDICTED: origin recognition complex subuni... 52 8e-06 >ref|XP_003544457.1| PREDICTED: origin recognition complex subunit 2-like isoform 2 [Glycine max] Length = 347 Score = 51.6 bits (122), Expect(2) = 8e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 879 RTLIEDFALTALTEYNVIVVTGYPQSINLKQVC 781 + LIEDFA T LTEY+V+V+ GY Q+INLKQVC Sbjct: 98 KVLIEDFASTELTEYSVVVINGYLQTINLKQVC 130 Score = 24.6 bits (52), Expect(2) = 8e-06 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 910 FGLLMYDFGSK 878 FGLLMY FGSK Sbjct: 87 FGLLMYGFGSK 97