BLASTX nr result
ID: Atractylodes22_contig00031461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00031461 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521356.1| ankyrin repeat-containing protein, putative ... 68 1e-16 ref|XP_002521359.1| ankyrin repeat-containing protein, putative ... 69 1e-16 ref|XP_002521353.1| protein binding protein, putative [Ricinus c... 69 5e-15 ref|XP_002521360.1| ankyrin repeat-containing protein, putative ... 65 2e-14 ref|XP_003541609.1| PREDICTED: ankyrin repeat-containing protein... 72 2e-14 >ref|XP_002521356.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223539434|gb|EEF41024.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 525 Score = 68.2 bits (165), Expect(2) = 1e-16 Identities = 35/62 (56%), Positives = 43/62 (69%) Frame = +2 Query: 5 FVRILLHKKPMLAMSMDSLRRTPLHLASAEGHVEIVRELLHVMGRDGCFHDQDGRTPLHL 184 F R LL +KP L+ +DS RR PLHLASAEG+++IV+ELL DQ+GR PLHL Sbjct: 65 FARALLSRKPKLSNELDSHRRLPLHLASAEGYLDIVKELLDASPDACSARDQEGRIPLHL 124 Query: 185 AA 190 AA Sbjct: 125 AA 126 Score = 43.1 bits (100), Expect(2) = 1e-16 Identities = 19/44 (43%), Positives = 28/44 (63%) Frame = +1 Query: 187 CVGYNRFEALKELSRLWNEDDLAKMTDRNGNTLLHLAIRIEKAD 318 CV YNR EALK L +D+ +D NGNT+LHL+ +++ + Sbjct: 159 CVEYNRLEALKLLVETARDDEFVNASDDNGNTILHLSAILKQVE 202 >ref|XP_002521359.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223539437|gb|EEF41027.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 474 Score = 68.9 bits (167), Expect(2) = 1e-16 Identities = 35/63 (55%), Positives = 40/63 (63%) Frame = +2 Query: 2 DFVRILLHKKPMLAMSMDSLRRTPLHLASAEGHVEIVRELLHVMGRDGCFHDQDGRTPLH 181 DF R +L P +A +DSL R+PLHLASAEGH EIV+ LL DQD R PLH Sbjct: 55 DFTRAILENCPKMASEIDSLNRSPLHLASAEGHTEIVKALLRAYADVYVVRDQDDRIPLH 114 Query: 182 LAA 190 LAA Sbjct: 115 LAA 117 Score = 42.4 bits (98), Expect(2) = 1e-16 Identities = 19/42 (45%), Positives = 28/42 (66%) Frame = +1 Query: 187 CVGYNRFEALKELSRLWNEDDLAKMTDRNGNTLLHLAIRIEK 312 CV YN EALK L + N D+L +++GNT+LHLA +++ Sbjct: 149 CVKYNLLEALKLLIEMVNNDELVNKANQDGNTILHLASMLKQ 190 >ref|XP_002521353.1| protein binding protein, putative [Ricinus communis] gi|223539431|gb|EEF41021.1| protein binding protein, putative [Ricinus communis] Length = 492 Score = 69.3 bits (168), Expect(2) = 5e-15 Identities = 34/63 (53%), Positives = 43/63 (68%) Frame = +2 Query: 2 DFVRILLHKKPMLAMSMDSLRRTPLHLASAEGHVEIVRELLHVMGRDGCFHDQDGRTPLH 181 DF +L + P +A +DSL+R+PLHLASAEGH EI++ LL V D+DGR PLH Sbjct: 59 DFTTAILTQNPKMATRLDSLKRSPLHLASAEGHTEIIKALLAVDNDVCLVRDEDGRIPLH 118 Query: 182 LAA 190 LAA Sbjct: 119 LAA 121 Score = 36.2 bits (82), Expect(2) = 5e-15 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = +1 Query: 187 CVGYNRFEALKELSRLWNEDDLAKMTDRNGNTLLHLAIRIEKAD 318 CV YN EAL+ L + +L +++GNT+LHLA+ +++ + Sbjct: 153 CVKYNHLEALRLLVETVDGVELVSRGNQDGNTILHLAVMLKQLE 196 >ref|XP_002521360.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223539438|gb|EEF41028.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 438 Score = 65.5 bits (158), Expect(2) = 2e-14 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 1/59 (1%) Frame = +2 Query: 17 LLHKKPMLAMSMDSLRRTPLHLASAEGHVEIVRELLHVMGRDGCF-HDQDGRTPLHLAA 190 +L K P +A+ +DSL+R+PLHLASAEGH +IV+ LL V D C D+DGR PLHLAA Sbjct: 60 VLKKCPAMAIKLDSLQRSPLHLASAEGHTDIVKVLLAV-NTDVCLVRDEDGRIPLHLAA 117 Score = 38.5 bits (88), Expect(2) = 2e-14 Identities = 17/41 (41%), Positives = 28/41 (68%) Frame = +1 Query: 190 VGYNRFEALKELSRLWNEDDLAKMTDRNGNTLLHLAIRIEK 312 V YN +ALK L + ++DDL +++GNT+LHLA +++ Sbjct: 150 VKYNHLKALKLLVEMVSDDDLVNKENQDGNTILHLAAMLKQ 190 >ref|XP_003541609.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Glycine max] Length = 444 Score = 72.0 bits (175), Expect(2) = 2e-14 Identities = 36/64 (56%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = +2 Query: 2 DFVRILLHKKPMLAMSMDSLRRTPLHLASAEGHVEIVRELLHVMGRDGC-FHDQDGRTPL 178 DF + LL KP LA+ +D +RTPLHLASA+GHVEIV LL C DQDGR P+ Sbjct: 60 DFTKSLLRHKPQLALELDHSKRTPLHLASAQGHVEIVHVLLQTYHEHACLMSDQDGRIPI 119 Query: 179 HLAA 190 H AA Sbjct: 120 HYAA 123 Score = 31.6 bits (70), Expect(2) = 2e-14 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +1 Query: 187 CVGYNRFEALKELSR---LWNEDDLAKMTDRNGNTLLHLAIRIEKAD 318 CV +N E LK L + L D L K +GNT+LH A+ +++ + Sbjct: 156 CVEHNHLETLKTLVQVRDLSGNDFLNKTDLHHGNTILHFAVTLKQVE 202